KEGG   Propionibacterium acnes ATCC 11828: TIIST44_09665Help
Entry
TIIST44_09665     CDS       T01972                                 

Definition
isochorismatase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TIIST44_09665
Enzymes [BR:pad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TIIST44_09665
    3.5.1.-  
     TIIST44_09665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051749..2052330
Genome map
AA seq 193 aa AA seqDB search
MTSSHRALLVVDVQPTFCEGGALAVTGGNACAERIATYIPTHHNCYDMVVTTQDWHIDPG
NHFSNNPDFVDSWPPHGVVGTDEAEIHPAIAKIPVGARVKKGQYAAAYSGFEGTTEDGSI
LETVLRDRGIEAVDIVGLALSHCVKDTALDAQRLRFVTTCLTDLSEPVSPEMGKAAVAVM
EDAGVTVTTSSQL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgtcacaccgtgcccttctcgtcgtggacgtccagccgaccttctgcgaggga
ggcgctctggctgtcacgggtggcaatgcctgcgccgagcggatcgcgacgtatatccca
acccaccacaattgttacgacatggtcgtcaccactcaggattggcatattgatcccggt
aaccatttctccaacaaccccgactttgtggactcctggccgccacatggagttgttggc
accgacgaagctgagattcatccggcgatcgctaagattcctgtcggcgcacgggttaag
aaaggccaatacgctgcggcctattccggtttcgaagggactaccgaggacgggtcaatt
ctcgagacggtattgcgtgatcgcggaatcgaggctgtcgacatcgtcggcttggctctg
tcccactgcgtcaaagacacggctctagacgcccagcgtctcaggttcgtcacgacatgc
ctgaccgacctcagcgagccggtcagcccagagatgggcaaggcagccgtggcggttatg
gaagatgccggagtaacggtcaccactagttcacagctctga

DBGET integrated database retrieval system