KEGG   Propionibacterium acnes ATCC 11828: TIIST44_10100Help
Entry
TIIST44_10100     CDS       T01972                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_10100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_10100
   00620 Pyruvate metabolism
    TIIST44_10100
   00640 Propanoate metabolism
    TIIST44_10100
  Energy metabolism
   00680 Methane metabolism
    TIIST44_10100
Enzymes [BR:pad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIIST44_10100
Lipid biosynthesis proteins [BR:pad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIIST44_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2139604..2139789)
Genome map
AA seq 61 aa AA seqDB search
MVGDGTCPITDTWWQTETGMFQITTVPSMPLKPGAAGRPVAVVDEEGNEVPAGKEGFLVP
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgacggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatg
ttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgctgggcgtccggtt
gctgttgtcgacgaggagggcaatgaggtccctgcgggcaaagagggcttcctcgtcccc
aagtga

DBGET integrated database retrieval system