KEGG   Propionibacterium acnes ATCC 11828: TIIST44_10385Help
Entry
TIIST44_10385     CDS       T01972                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_10385 (tpiA)
   01230 Biosynthesis of amino acids
    TIIST44_10385 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_10385 (tpiA)
   00051 Fructose and mannose metabolism
    TIIST44_10385 (tpiA)
   00562 Inositol phosphate metabolism
    TIIST44_10385 (tpiA)
Enzymes [BR:pad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TIIST44_10385 (tpiA)
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TIIST44_10385 (tpiA)
  Exosomal proteins of bladder cancer cells
   TIIST44_10385 (tpiA)
  Exosomal proteins of melanoma cells
   TIIST44_10385 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2197466..2198245)
Genome map
AA seq 259 aa AA seqDB search
MSRTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIID
GDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKA
KKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGIPAEQVAKLVIAYEPIWAIG
TGETATADDAQEVCQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV
GGASLKAGDFSKIVTFYEA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccccgatcatggccggcaactggaagatgaacctcgaccacgttgccgct
acctccctcgtccaggatctcggtgaggccctcaaggccgcgggatacgactcctccaag
tcagaggccgtcgtcatcccgccgttcactgatatccgtcctgtcgccatcatcattgat
ggtgacaagttgccgatcgcctacggtgcccaggatatttcggctcacgacgatggcgcc
tacaccggcgaggtgtccggcgccatgctgtcgaaactgggttgccgctatgtcgtcgtt
ggccactccgagcgtcgcgagtaccacaacgagtccgacgaactggtcaatgccaaggct
aagaaggtcatcgaaaatggaatgaccccaatcatctgctgtggtgaggccctcgaggtt
cgcaaggctggcaagcacgtcgagcataccgttggccagatcaaagccgaccttgacggc
attcctgccgaacaggtcgccaagcttgtcatcgcctacgagcccatctgggccatcggc
actggcgagactgccaccgctgacgatgcccaggaggtctgccaggccatccgcgaggcc
gtcaaggagctttacgacgccccgaccgccgaggcggtgcgcattcagtacggtggttcg
gttaaaccggccaacgtcgctgagatcatggccaagccggacgtcgacggcgctctcgtt
ggcggagcctcgctcaaagctggcgatttctccaagatcgtaactttctacgaggcctga

DBGET integrated database retrieval system