KEGG   Propionibacterium acnes ATCC 11828: TIIST44_10425Help
Entry
TIIST44_10425     CDS       T01972                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_10425
   01230 Biosynthesis of amino acids
    TIIST44_10425
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_10425
  Energy metabolism
   00680 Methane metabolism
    TIIST44_10425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_10425
Enzymes [BR:pad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIIST44_10425
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIIST44_10425
  Exosomal proteins of melanoma cells
   TIIST44_10425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2207761..2208507
Genome map
AA seq 248 aa AA seqDB search
MHLLLIRHGQSENNAFAAQSVETYQQGRKPDPELTELGRRQAQALGNWIGSVSPRPTKLY
ASPMMRTIQTADPVAEALDLPIIINDLIFERPGPVQIVDGAETGHPGSPRSALSAITDRA
VFPESITEDGWREARIETASEAADRAGRIAKWIRDTHNDDECIAIVAHGAIGSMVLLHLI
APQLATDLRNHSIGSEPHWIGLQNTATSMIELHPDGYEVHWINRVDHLIEAGMVHGAVAT
STGNPGTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcttctcctcatccgccacggccagtccgagaacaatgccttcgctgcgcagtct
gtcgagacttaccagcagggtcgcaagcctgacccggagctcaccgagcttggacgacgt
caagctcaggccctagggaactggatcggatcggtctctcctcggccaacgaagctgtat
gcctcccccatgatgcgtaccatccagacggctgacccggtcgctgaggcccttgatctt
cctatcatcatcaatgacctcatcttcgagcgtccaggcccagttcagatcgttgacggc
gccgaaaccggtcatccaggatcgccgcgatcagcgttgtcggccatcacagaccgtgct
gttttccccgagtccatcaccgaggacgggtggcgcgaagctcgcatcgagaccgcctcc
gaggctgctgaccgcgccggcagaatagccaagtggatccgcgatacccacaatgatgac
gagtgcatcgcgatcgtcgcccacggcgcgatcggatccatggtgttgctgcatctcatc
gccccacaacttgccactgatctgcgaaaccactccatcggcagcgaaccgcactggatc
gggcttcaaaacaccgccacctcgatgatcgagttgcacccggacgggtacgaagttcat
tggatcaatcgcgtggatcaccttatcgaagccggtatggttcacggcgccgtcgccaca
tccaccggcaaccccggtacccgctga

DBGET integrated database retrieval system