KEGG   Propionibacterium acnes ATCC 11828: TIIST44_10675Help
Entry
TIIST44_10675     CDS       T01972                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TIIST44_10675
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TIIST44_10675
Enzymes [BR:pad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TIIST44_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2268031..2269620)
Genome map
AA seq 529 aa AA seqDB search
MSPESTVPPTPPAGAALRPSQGDPVGWTDLVASFDSCRANDNGPAITGITLDSRQVRPGD
LYVGLHGLHAHGASFAASAVESGAVAVLTDEDGAILAAEAGVPIIVVDDPRAAMAVAAAK
VFGHPSDAMTMFGITGTNGKTTTAFLVEAGLCAAGHHVGTIGTIGFRLDGEELPSARTTV
TTPEAPDLQGLFAAMAERGASDVVMEVSSHALALQRVDGTCFDVVAFTNLGRDHLDFHNT
LDNYFNAKARLFTPDLARVGVINVDDPRGRQLVERMQANGVKAVTTSIHQPSDYQVTSWH
AARAGAIFDVSTPSGERTLELSLPGEFNVRNAAMALAMLEAAGLAFDDVADGLCSAQVPG
RMERVDLADDAPTALVDFAHTPQAIASALDAARSSVDGGRLIAVLGAGGDRDVAKRGPMG
QIAAERADIVIVTDDNPRTEDPAVIRAAVLEGAHEAAGDGVIVIDGGRRREAINEALRMA
EAGDVICVLGKGHETGQSIGSEVLPFDDREVIRAEWKIMARQSEEDQAR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgagccctgaatctactgtcccccccactccacctgctggtgctgccctccgaccatcc
cagggtgatcctgtcgggtggaccgacctagtggcctccttcgacagctgccgagctaat
gacaacggtcctgcgatcaccgggatcacattggactcccgccaggttcgcccgggcgat
ctctacgtcggtctgcacggcctgcatgctcacggggcgagtttcgctgcctctgctgtt
gagtcgggtgcagtcgcagtgctcactgacgaggatggtgccatactggcggcggaggcg
ggtgtgccgatcattgtcgttgacgatccgcgcgctgccatggctgttgcggccgctaag
gtctttggacacccctcggatgccatgacgatgtttggtattacggggactaacggtaaa
accacaacggccttcctcgtggaggccggattgtgtgcggctggccaccatgttgggact
atcgggacgattggattccggctcgacggtgaggagttgcctagtgctcgcaccaccgtc
acgacgccggaggccccagatctgcaagggctattcgcggcgatggctgagcgaggtgct
tctgacgtcgtgatggaggtgtcgtcgcacgctctggccttgcagcgggtggatggaacc
tgtttcgatgtcgtggctttcaccaacctaggccgtgaccatctggatttccataacacc
cttgataattatttcaacgctaaggcccgtttgttcacccccgatctggctcgggttggc
gttattaatgtcgatgacccgcgtggtcgtcagctagttgagcgtatgcaagccaacggg
gttaaggccgtgacgacgtcaatccatcagccctctgactatcaggtgacgtcatggcat
gccgcgcgtgccggggcgattttcgacgtgagcactccgtcgggggagcgcaccctcgag
ctgtccttgcccggcgaattcaatgtccgcaacgcagctatggctctggccatgctcgag
gctgccgggctcgcttttgacgatgttgcagatggtttgtgttccgctcaggtgcctggc
cgtatggagcgggtcgatctcgcagatgacgccccgacggccctcgtggactttgcgcac
actccgcaagcgattgcatcagctcttgatgccgctcggtcgtcagtcgatggcggccgt
cttatcgccgtgctcggtgctgggggagaccgtgacgtggccaagcgcggtccaatgggc
cagattgccgctgagcgtgccgatatcgtcatcgttactgatgacaacccgcgtaccgaa
gatcctgcggtgatccgtgcagccgtgctggagggggcccatgaagctgctggtgacggg
gtcattgtgatcgacgggggacgtcgtcgtgaggcgattaacgaggccctgcggatggcg
gaggctggcgacgttatctgcgtgctcggcaagggacatgagaccgggcagagcattggc
agtgaggtgctgccgttcgacgatcgtgaggttatccgggccgaatggaagatcatggcc
cggcagagcgaggaggatcaggcacgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system