KEGG   Propionibacterium acnes ATCC 11828: TIIST44_10990Help
Entry
TIIST44_10990     CDS       T01972                                 

Definition
dihydrolipoamide acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_10990
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIIST44_10990
  Amino acid metabolism
   00310 Lysine degradation
    TIIST44_10990
Enzymes [BR:pad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TIIST44_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2330206..2331576
Genome map
AA seq 456 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAKPTAEPAEKAEPEPVKSEAEEAPAPAAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAPAPAAPKPASSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVES
LQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNAN
IDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVTP
DELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDMM
YLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctaagccgacggctgagcccgcagaaaaggccgagcctgag
ccggtgaagagcgaggccgaggaggcccctgcgccggccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaacccatcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaggctccctcagctcctcaggcaccggctgcccctgccccggctgctccgaaa
ccggctagttcagcccgtaaggcctcccaggaagtctctccggaggctgccgctctgcgc
ggcaccaccgaaaagatgagccgtctacgcaaagtcatcgcctcgcggatggttgagtcc
ctacagatctcggctcagttgacggccaccgtcgaagtggacatgaccgctatctcccgc
atccgcaacgctgagaaggctgctttcaaggctcgcgagggagtcggtctgtcctacctg
cctttcattactaaggccgtcgttgaggccctcaaggccaatccgaccttcaacgcaaat
atcgacaccgaggcggggacgatcacctacggttcttctgagaacatcggcatcgccgtt
gataccccgcgcgggctgctggttccggtcatcaagaacgccggtgatctcaatatcgct
gggttggcccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtaacccct
gacgagctgtccggcggcaccttcaccatcaccaactatggctcggccggtgccctcttc
gacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggttaag
cgcccagtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatgatg
tacctctcgctgtcctacgaccaccggctcattgacggcgccgtggcggctcgcttccta
tcgggcatcaaggctcgtctggaagagggcgacttcgccggagagttctga

DBGET integrated database retrieval system