KEGG   Propionibacterium acnes ATCC 11828: TIIST44_10990Help
Entry
TIIST44_10990     CDS       T01972                                 

Definition
dihydrolipoamide acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_10990
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIIST44_10990
  Amino acid metabolism
   00310 Lysine degradation
    TIIST44_10990
Enzymes [BR:pad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TIIST44_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2330206..2331576
Genome map
AA seq 456 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAKPTAEPAEKAEPEPVKSEAEEAPAPAAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAPAPAAPKPASSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVES
LQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNAN
IDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVTP
DELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDMM
YLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctaagccgacggctgagcccgcagaaaaggccgagcctgag
ccggtgaagagcgaggccgaggaggcccctgcgccggccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaacccatcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaggctccctcagctcctcaggcaccggctgcccctgccccggctgctccgaaa
ccggctagttcagcccgtaaggcctcccaggaagtctctccggaggctgccgctctgcgc
ggcaccaccgaaaagatgagccgtctacgcaaagtcatcgcctcgcggatggttgagtcc
ctacagatctcggctcagttgacggccaccgtcgaagtggacatgaccgctatctcccgc
atccgcaacgctgagaaggctgctttcaaggctcgcgagggagtcggtctgtcctacctg
cctttcattactaaggccgtcgttgaggccctcaaggccaatccgaccttcaacgcaaat
atcgacaccgaggcggggacgatcacctacggttcttctgagaacatcggcatcgccgtt
gataccccgcgcgggctgctggttccggtcatcaagaacgccggtgatctcaatatcgct
gggttggcccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtaacccct
gacgagctgtccggcggcaccttcaccatcaccaactatggctcggccggtgccctcttc
gacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggttaag
cgcccagtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatgatg
tacctctcgctgtcctacgaccaccggctcattgacggcgccgtggcggctcgcttccta
tcgggcatcaaggctcgtctggaagagggcgacttcgccggagagttctga

DBGET integrated database retrieval system