KEGG   Pseudomonas aeruginosa PAO1: PA0036Help
Entry
PA0036            CDS       T00035                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PA0036 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA0036 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PA0036 (trpB)
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PA0036 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(37890..39098)
Genome map
AA seq 402 aa AA seqDB search
MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPAFQEELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGVPGVLHGNRTFLLQDADGQI
IDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALEAFHTCCRLEGIIPALESSHA
LAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQESKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatcgcaacggccccgacgccaagggcctgttcggccgcttcggcggccag
tacgtcgccgagaccctgatgccgctgatcctcgacctcgcccgcgagtacgagaaggcc
aaggacgacccggcgttccaggaggaactggcctacttccagcgcgactacgtcggtcga
ccgagcccgctgtacttcgccgagcgcctgaccgagcactgcggcggggcgaagatctac
ctcaagcgcgaggagctgaaccataccggcgcgcacaagatcaacaactgcatcggccag
atcctcctggcccggcgcatgggcaagaaacgcatcatcgccgagaccggcgccggcatg
cacggcgtggccactgccaccgtcgccgcgcgcttcggcctgcagtgcgtgatctacatg
ggcaccaccgacatcgaccggcagcaggccaacgtcttccgcatgaagctgctgggcgcc
gaggtgatcccggtgaccgccggcaccggtaccctgaaggacgccatgaacgaggcgctg
cgcgactgggtgaccaacgtcgacagcaccttctacctgatcggcacggtcgccggcccg
catccgtacccggcgatggtccgcgacttccaggcggtgatcggcaaggaaacccgcgag
caactggccgagaaggaagggcgcctgcccgattcgctggtcgcctgcatcggcggcggc
tccaacgccatgggcctgttccacccgttcctcgacgacgccggggtgcagatcgtcggc
gtggaagccgccggccacggcatcgacaccggcaagcacgcggccagcctgaacggcggg
gttcccggcgtgctgcacggcaaccgcaccttcctgctgcaggacgcggatggccagatc
atcgacgcacactccatctccgccggcctcgactatcccggcatcggcccggaacacgcc
tggctgcacgacaccggccgcgtcgagtacacctcgatcaccgacgacgaagccctggag
gccttccacacctgctgccgcctcgaaggcatcatcccggcactggaaagctcccatgcc
ctggccgaggtcttcaagcgtgcgcccagcctgcccaaggagcacatcatggtggtgaac
ctgtccggtcgcggcgacaaggacatgcagaccgtcatgcaccacatgcaacaggagtcg
aaagcatga

DBGET integrated database retrieval system