KEGG   Pseudomonas aeruginosa PAO1: PA0266Help
Entry
PA0266            CDS       T00035                                 

Definition
(RefSeq) 5-aminovalerate aminotransferase DavT
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00250  Alanine, aspartate and glutamate metabolism
pae00310  Lysine degradation
pae00650  Butanoate metabolism
pae01100  Metabolic pathways
pae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PA0266
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA0266
   00310 Lysine degradation
    PA0266
Enzymes [BR:pae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PA0266
    2.6.1.48  5-aminovalerate transaminase
     PA0266
Amino acid related enzymes [BR:pae01007]
 Aminotransferase (transaminase)
  Class III
   PA0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 880917
NCBI-ProteinID: NP_248957
PathoGenesis: PA0266
UniProt: Q9I6M4
Position
301218..302498
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIEL
FEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgctgaagcgtcgccaggccgcggtaccccgcggcgtg
ggccagatccacccggtcgtcgccgagcgcgccgagaactccaccgtctgggacgtggaa
ggccgcgagtacatcgacttcgccggcggcatcgccgtgctgaacaccggccacctgcat
ccgaaggtgatcgccgcggtccaagagcaactgggcaagctgtcccacacctgcttccag
gtgctggcctacgaaccctacatcgagctggccgaggaaatcgccaagcgcgtgccgggc
gacttcccgaagaagaccctgctggtcacctccggctccgaagccgtggagaacgccgtc
aagatcgcccgcgccgccaccggccgcgctggcgtgatcgccttcaccggcgcgtaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggtggtcccgtactccgccggcatg
ggcctgatgccgggcggcatcttccgcgccctggcgccctgcgagctgcacggcgtgagc
gaggacgactccatcgccagcatcgagcgcatcttcaagaacgatgcccagccccaggac
atcgccgcgatcatcatcgagccggtgcagggcgagggtggcttctacgtcaactccaag
tccttcatgcagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtgcagaccggcgccggccgtaccggcaccttcttcgctaccgagcaactgggcatc
gttcctgacctgaccaccttcgccaagtcggtcggcggcggcttcccgatctccggcgtg
gccggcaaggccgagatcatggacgccatcgcgcccggcggcctgggcggcacctatgcc
ggcagcccgatcgcctgcgccgcggcactggccgtgctgaaggtgttcgaggaagagaag
ctgttggaacgttcgcaagccgtcggcgagcgcctcaaggccggcctgcgcgagatccag
gccaagcacaaggtgatcggcgacgttcgtggcctgggttcgatggtggccatcgagctg
ttcgagggcggcgatacccacaagccggccgccgagctggtcagcaagatcgtcgtccgt
gcgcgcgagaagggcctgatcctgctctcctgcggcacctactacaacgtcatccgcttc
ctcatgcccgtcaccatccccgacgcgcaactggagaagggcctggccatcctggccgag
tgcttcgacgaactcgcttaa

DBGET integrated database retrieval system