KEGG   Pseudomonas aeruginosa PAO1: PA0288Help
Entry
PA0288            CDS       T00035                                 

Gene name
gpuA
Definition
3-guanidinopropionase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PA0288 (gpuA)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PA0288 (gpuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Structure
PDB: 

Jmol
Position
323616..324572
Genome map
AA seq 318 aa AA seqDB search
MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPRE
VRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPL
SVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDP
LRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFD
VDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGA
TMMFELLCLLAESAARSA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaccatccgcagcccctcgacgccgccgagattccccgcttcgccggtatc
ccgaccttcatgcgcctgccggcgttcaccgacccggcggcgctgcaggtcggcctgatc
ggcgtgccctgggatggcggcaccaccaaccgcgccggtgcccgccatggcccgcgcgag
gtgcgcaacctgtccagcctgatgcgcaaggtgcatcacgtcagccgcatcgcgccctac
gacctggtgcgggtcggcgatctcggcgacgcgccggtgaatcccatcgacctgctcgat
tcgctgcgccgcatcgaaggcttctatcgccaggtccatgccgccggtaccctgccgctg
tcggtcggtggcgaccacctggtgaccctgccgatctttcgcgccctgggtcgcgagcgg
ccgctgggcatggtgcatttcgatgcgcattccgataccaacgaccgctacttcggcgac
aacccctacacccacggcacgccattccgccgagccatagaggaaggcctgctcgatccg
ctgcgcacggtgcagatcggcatccgcggctcggtgtattcgccggacgacgacgctttc
gcccgcgagtgcggcatccgcgtgatccacatggaggagttcgtcgaactgggcgtcgag
gcgaccctggccgaagcgcggcgggtggtgggcgccgggccgacctatgtgagtttcgac
gtcgacgtgctcgacccggccttcgcgcccggcaccggcaccccggagatcggcggcatg
accagcctccaggcccagcagctggtccgcggcctgcgcgggctggacctggtcggcgcc
gacgtggtggaagtctcgccgccgttcgatgtcggcggcgccacggcgctggtgggggcg
accatgatgttcgagctgctctgcctgcttgccgagtcggccgcgcgaagcgcctga

DBGET integrated database retrieval system