KEGG   Pseudomonas aeruginosa PAO1: PA0350Help
Entry
PA0350            CDS       T00035                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA0350 (folA)
   00670 One carbon pool by folate
    PA0350 (folA)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PA0350 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
393308..393814
Genome map
AA seq 168 aa AA seqDB search
MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIMGRKTWDSLGRPLPGR
LNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLIGGAQLYAEALPRAARL
YLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFEVWERR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaccgctggcgatgatcgccgcccttggcgagaaccgcgcgatcggcatcgac
aaccgcctgccctggcgcctgccggccgacctcaagcatttcaaggcgatgaccctcggc
aagccggtgatcatggggcgcaagacctgggactcgctgggtcggccgctgccgggccgg
ctaaacctggtggtcagccgccaggccggcctggcactggagggtgcggaagtgttcgcc
agcctggacgccgcgctggcgcgcgccgaggcgtgggcgcaggcggaggacgccgacgaa
ctgatgctgatcggcggcgcccagctctatgccgaggccttgccgcgcgccgcgcgtctc
tacctgacccgggttggcctggcgccggagggcgacgcctttttccccgagatcgatggt
gcggcctggcgcctggcgtcgagcatcgaacacgccgcggctgacgatgcgcctgcctac
gccttcgaggtatgggagcgccgctga

DBGET integrated database retrieval system