KEGG   Pseudomonas aeruginosa PAO1: PA0357Help
Entry
PA0357            CDS       T00035                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pae00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PA0357 (mutM)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PA0357 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PA0357 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
401131..401943
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRLSGQRIVSVERRAKYL
LLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMALRYTDPRRFGAMLWSLA
PLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAA
GIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFVGGDGQPGYFQQELFVYGR
GGEFCKVCGSTLREIRLGQRASVYCPRCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactacccgaagtcgaaaccacccgccggggcatcgccccctacctcgaaggc
cagcgcgtcgagcgcgtgatcgtgcgcgagcggcgcctgcgctggccgattcccgaagac
ctggacgtgcgcctgtccggacaacgcatcgtcagcgtcgagcgccgcgccaagtacctg
ctgctgggcgccgaggccggtacgctgatcagccacctgggcatgtccggcagcctgagg
ctggtggagagcggcaccccggccagtcgccacgagcacgtcgacatcgagctggcctcg
ggcatggccctgcgctacaccgatccgcggcgcttcggcgccatgctctggagcctggcg
ccactggaacacgagttgctgcgcaacctcggcccggaaccgctgaccgacgctttcgcc
ggccagcgtctgttcgagctgtcgcgcgggcggagcatggcggtcaagccgttcatcatg
gacaacgcggtggtggtcggggtcggcaacatctacgccagcgaagcgctgttcgccgcc
ggcatcgatccgcgcaagcccgccgggagcatctccaaggcgcgctacctgcgcctggcg
gaggagatcaagcggatcctggcgatcgccatcgagcgcggcggcaccaccctgcgcgat
ttcgtcggcggcgacggccagcccggttacttccagcaggaattgttcgtctatggccgt
ggcggggagttctgcaaggtctgcggcagcaccctgcgcgagatccgcctaggccagcgc
gccagcgtgtactgcccgcgctgccaacgctga

DBGET integrated database retrieval system