KEGG   Pseudomonas aeruginosa PAO1: PA0555Help
Entry
PA0555            CDS       T00035                                 

Gene name
fda
Definition
fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PA0555 (fda)
   01230 Biosynthesis of amino acids
    PA0555 (fda)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA0555 (fda)
   00030 Pentose phosphate pathway
    PA0555 (fda)
   00051 Fructose and mannose metabolism
    PA0555 (fda)
  Energy metabolism
   00680 Methane metabolism
    PA0555 (fda)
Enzymes [BR:pae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PA0555 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
613338..614402
Genome map
AA seq 354 aa AA seqDB search
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP
FLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLREDGKTPADYDY
NVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAEGVLDHSQLLTDPEEAAD
FVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHARIPDTHLVMHGSSSVPQD
WLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAIRRFLAQNPSEFD
PRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGMFQRYARGELDPKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactcatcagcatgcgccagatgctggatcacgccgccgaattcggctacggcgtg
ccggccttcaacgtcaacaacctcgagcagatgcgcgccatcatggaagcggcggacaag
accgattcgcccgtgatcgtccaggcttccgccggtgctcgcaaatacgccggcgcgccc
ttcctgcgccacctgatcctcgccgcgatcgaagaattcccgcacatcccggtggtcatg
caccaggatcacggcaccagtcccgacgtctgccagcgttccatccagctgggcttcagc
tcggtgatgatggacggctccctgcgtgaagacggcaagacccctgccgactacgactac
aacgtccgtgtgacccagcagaccgtggcgttcgcccatgcctgcggcgtgtccgtggaa
ggcgagctgggctgcctgggttccctggaaaccggcatggccggcgaggaagacggcgtc
ggcgcggaaggcgtgctggaccacagccagttgctgaccgatccggaagaagccgccgac
ttcgtgaagaagaccaaggtcgacgccctggccatcgccatcggcaccagccacggcgcc
tacaagttcaccaagccgccgaccggggacaccctgtcgatccagcgcatcaaggaaatc
cacgcgcgcatcccggacacccacctggtgatgcacggctcttcctcggtaccgcaggac
tggctggcgatcatcaacgagtacggcggcgagatcaaagagacctacggcgtgccggtc
gaggaaatcgtcgagggcatcaagtacggcgtgcgcaaggtgaacatcgacaccgacctg
cgcctggcctccaccggtgccatccgccgcttcctggcgcagaacccgagcgagttcgac
ccgcgcaagtacttctccaagaccgtcgaggccatgcgcgacatctgcatcgctcgctac
gaagccttcggcaccgccggcaacgcttccaagatcaagccgatctccctggaaggcatg
ttccagcgctacgctcgcggcgagctggatccgaaggtcaactaa

DBGET integrated database retrieval system