KEGG   Pseudomonas aeruginosa PAO1: PA0555Help
Entry
PA0555            CDS       T00035                                 

Gene name
fda
Definition
fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PA0555 (fda)
   01230 Biosynthesis of amino acids
    PA0555 (fda)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA0555 (fda)
   00030 Pentose phosphate pathway
    PA0555 (fda)
   00051 Fructose and mannose metabolism
    PA0555 (fda)
  Energy metabolism
   00680 Methane metabolism
    PA0555 (fda)
Enzymes [BR:pae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PA0555 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
613338..614402
Genome map
AA seq 354 aa AA seqDB search
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP
FLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLREDGKTPADYDY
NVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAEGVLDHSQLLTDPEEAAD
FVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHARIPDTHLVMHGSSSVPQD
WLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAIRRFLAQNPSEFD
PRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGMFQRYARGELDPKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactcatcagcatgcgccagatgctggatcacgccgccgaattcggctacggcgtg
ccggccttcaacgtcaacaacctcgagcagatgcgcgccatcatggaagcggcggacaag
accgattcgcccgtgatcgtccaggcttccgccggtgctcgcaaatacgccggcgcgccc
ttcctgcgccacctgatcctcgccgcgatcgaagaattcccgcacatcccggtggtcatg
caccaggatcacggcaccagtcccgacgtctgccagcgttccatccagctgggcttcagc
tcggtgatgatggacggctccctgcgtgaagacggcaagacccctgccgactacgactac
aacgtccgtgtgacccagcagaccgtggcgttcgcccatgcctgcggcgtgtccgtggaa
ggcgagctgggctgcctgggttccctggaaaccggcatggccggcgaggaagacggcgtc
ggcgcggaaggcgtgctggaccacagccagttgctgaccgatccggaagaagccgccgac
ttcgtgaagaagaccaaggtcgacgccctggccatcgccatcggcaccagccacggcgcc
tacaagttcaccaagccgccgaccggggacaccctgtcgatccagcgcatcaaggaaatc
cacgcgcgcatcccggacacccacctggtgatgcacggctcttcctcggtaccgcaggac
tggctggcgatcatcaacgagtacggcggcgagatcaaagagacctacggcgtgccggtc
gaggaaatcgtcgagggcatcaagtacggcgtgcgcaaggtgaacatcgacaccgacctg
cgcctggcctccaccggtgccatccgccgcttcctggcgcagaacccgagcgagttcgac
ccgcgcaagtacttctccaagaccgtcgaggccatgcgcgacatctgcatcgctcgctac
gaagccttcggcaccgccggcaacgcttccaagatcaagccgatctccctggaaggcatg
ttccagcgctacgctcgcggcgagctggatccgaaggtcaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system