KEGG   Pseudomonas aeruginosa PAO1: PA0555Help
Entry
PA0555            CDS       T00035                                 

Gene name
fda
Definition
fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pae01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pae01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pae00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pae00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pae00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:pae00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
613338..614402
Genome map
AA seq 354 aa AA seqDB search
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP
FLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLREDGKTPADYDY
NVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAEGVLDHSQLLTDPEEAAD
FVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHARIPDTHLVMHGSSSVPQD
WLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAIRRFLAQNPSEFD
PRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGMFQRYARGELDPKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactcatcagcatgcgccagatgctggatcacgccgccgaattcggctacggcgtg
ccggccttcaacgtcaacaacctcgagcagatgcgcgccatcatggaagcggcggacaag
accgattcgcccgtgatcgtccaggcttccgccggtgctcgcaaatacgccggcgcgccc
ttcctgcgccacctgatcctcgccgcgatcgaagaattcccgcacatcccggtggtcatg
caccaggatcacggcaccagtcccgacgtctgccagcgttccatccagctgggcttcagc
tcggtgatgatggacggctccctgcgtgaagacggcaagacccctgccgactacgactac
aacgtccgtgtgacccagcagaccgtggcgttcgcccatgcctgcggcgtgtccgtggaa
ggcgagctgggctgcctgggttccctggaaaccggcatggccggcgaggaagacggcgtc
ggcgcggaaggcgtgctggaccacagccagttgctgaccgatccggaagaagccgccgac
ttcgtgaagaagaccaaggtcgacgccctggccatcgccatcggcaccagccacggcgcc
tacaagttcaccaagccgccgaccggggacaccctgtcgatccagcgcatcaaggaaatc
cacgcgcgcatcccggacacccacctggtgatgcacggctcttcctcggtaccgcaggac
tggctggcgatcatcaacgagtacggcggcgagatcaaagagacctacggcgtgccggtc
gaggaaatcgtcgagggcatcaagtacggcgtgcgcaaggtgaacatcgacaccgacctg
cgcctggcctccaccggtgccatccgccgcttcctggcgcagaacccgagcgagttcgac
ccgcgcaagtacttctccaagaccgtcgaggccatgcgcgacatctgcatcgctcgctac
gaagccttcggcaccgccggcaacgcttccaagatcaagccgatctccctggaaggcatg
ttccagcgctacgctcgcggcgagctggatccgaaggtcaactaa

DBGET integrated database retrieval system