KEGG   Pseudomonas aeruginosa PAO1: PA0583Help
Entry
PA0583            CDS       T00035                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA0583
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PA0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
641417..641959
Genome map
AA seq 180 aa AA seqDB search
MSLIPVYLGLGSNVERERHLHAGLDALAGFLHDLRCSPVFESEPVGIKSGPFFNLVVSAR
TDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLFYGDLVGDFDGLVLPRAEVLKNAF
VLWPLSELAPNLEHPVARQPLGDLWREARIQQKLWPAPFEWRGQALTPEALLQAFPRSSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgatcccggtctacctcggcctcggcagcaatgtcgagcgtgagcgccacctg
catgccggcctcgatgcgctggccggtttccttcatgacctgcgttgctcgccggtgttc
gagagcgagccggtgggtatcaagagcgggccgttcttcaacctggtggtgtctgcccgc
accgatctgccgctggccgaactgagcctgcgactcaagcacatcgaggccgacaatggc
cgctatgcgccagagcgcaaggggctgccgctggatatcgacgtgctgttctacggcgac
ctggtgggcgatttcgatggcctggtgctgccgcgcgccgaagtgctgaagaacgctttc
gtgctctggcccttgtccgagctggcgccgaacctggagcatccggtcgcccgccagccg
ctgggcgatctctggcgcgaggcgaggatccagcagaagctctggccggcgccattcgaa
tggcgtggccaggcgttgactcccgaagcgctgcttcaggcctttccgcgttcttccttg
tag

DBGET integrated database retrieval system