KEGG   Pseudomonas aeruginosa PAO1: PA0966Help
Entry
PA0966            CDS       T00035                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PA0966 (ruvA)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PA0966 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
1051673..1052278
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGVGYEVEVPMTTLYRLPSVGEPVTLHTHLVVREDAHLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSTLVKIPGVGKKT
AERLLVELKDRFKAWENMPTIAPLVMEPRASATVSSAEADAVSALIALGFKPQEASRAVA
AVPGEDLSSEEMIRQALKGMV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgcttgcgtggcaccctggcggagaaacagccgccacacctgatcctcgat
gtgaatggcgtcggctatgaagtggaagtgccgatgacgaccctctatcggttgccttcg
gtgggcgagccggtgaccttgcatacccatctggttgtgcgtgaggatgcgcacttgctc
tatggcttcgccgaaaagcgcgagcgagagctgttccgtgagctgatccggctcaacggc
gtgggtccgaaactggccctggcgctgatgtcgggcctggaagtggacgaactggtgcgt
tgcgtccaggcacaggacacctccaccctggtgaagatccccggtgttggcaagaagacc
gccgagcgcctgctggtggagttgaaggaccgcttcaaggcttgggaaaacatgcccacg
attgcaccgttggtgatggaaccccgtgccagcgctacagtctcaagcgccgaggccgat
gcagtcagcgcgctgatcgccctcggcttcaagccacaggaagccagtcgtgccgtcgca
gccgtaccgggagaggatttgtccagcgaagaaatgatccgccaggccctgaagggcatg
gtctag

DBGET integrated database retrieval system