KEGG   Pseudomonas aeruginosa PAO1: PA1162Help
Entry
PA1162            CDS       T00035                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00300  Lysine biosynthesis
pae01100  Metabolic pathways
pae01120  Microbial metabolism in diverse environments
pae01230  Biosynthesis of amino acids
Module
pae_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PA1162 (dapE)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PA1162 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer BNR_2
Motif
Other DBs
NCBI-GeneID: 877783
NCBI-ProteinID: NP_249853
PathoGenesis: PA1162
UniProt: Q9I4H5
Position
complement(1259291..1260442)
Genome map
AA seq 383 aa AA seqDB search
MTASSPSLSPTLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEEVDNFWAR
RGGDGPVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVE
RFVADHPEHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDV
VKNGRRGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQ
VSNLNSGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLDWHVEWALSGLP
FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVNE
RVLASDLELLTEIYYQTLVRLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcttcgccgagtctctcgccgaccctcgaactcgcctgcgagttgatccgc
cgcccctccgtcacgccgctcgacgccgactgccaggccctgatgatgcgccgcctggaa
gccgccggcttcgccctggagccgatgcgcatcgaggaggtggacaacttctgggcacgg
cgcggcggcgacggcccggtgctgtgcttcgccgggcacaccgacgtggtccccaccggc
ccgctgcaggcctggcagcaccaacccttcgacgccctgatcgacgaccagggcatgctc
tgcgggcgcggcgcggcggacatgaaaggcagcctggcgtcgatgatcgtcgccgtcgag
cgcttcgtcgccgaccacccggagcacaagggtgccatcgccttcctcatcaccagcgac
gaggaaggcccggcccaccacggcaccaaggcggtggtcgaacgcctcgccgcacgcggc
gagcgcctggactggtgcatcgtcggcgaaccgtcgagcaccagcctggtcggcgacgtg
gtgaagaacggccgccgcggctccctcggcgccaagctgaccatccgcggcgtacagggc
catgtggcctacccgcacctggcgaagaacccgatccacctggccgccccggcgctggcc
gaactggcggcggaacactgggacgacggcaatgccttcttcccgccgaccagcttccag
gtttccaacctgaactccggcaccggcgccaccaacgtcatccccggcgaactgaccgcg
ctgttcaacttccgcttctccaccgaatccaccgtcgaaggcctgcagaaacgcgtcgag
gcgatcctcgacaagcacggcctggactggcacgtcgaatgggcgctgtccggcctgccg
ttcctcaccgagccgggcgaactgctcgatgcggtggccgccagcatcagggcggtcacc
ggtcgcgagacccagccctcgaccagcggcggcacctccgacggacgcttcatcgccacc
atgggcacccaggtggtcgaactcggcccggtcaacgccaccatccaccaggtcaacgag
cgggtcctggccagcgacctggaactgctcaccgaaatctactaccagaccctggtgagg
ctgctcgcctga

DBGET integrated database retrieval system