KEGG   Pseudomonas aeruginosa PAO1: PA1249Help
Entry
PA1249            CDS       T00035                                 

Gene name
aprA
Definition
alkaline metalloproteinase
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Structure
PDB: 

Jmol
Position
1355631..1357070
Genome map
AA seq 479 aa AA seqDB search
MSSNSLALKGRSDAYTQVDNFLHAYARGGDELVNGHPSYTVDQAAEQILREQASWQKAPG
DSVLTLSYSFLTKPNDFFNTPWKYVSDIYSLGKFSAFSAQQQAQAKLSLQSWSDVTNIHF
VDAGQGDQGDLTFGNFSSSVGGAAFAFLPDVPDALKGQSWYLINSSYSANVNPANGNYGR
QTLTHEIGHTLGLSHPGDYNAGEGDPTYADATYAEDTRAYSVMSYWEEQNTGQDFKGAYS
SAPLLDDIAAIQKLYGANLTTRTGDTVYGFNSNTERDFYSATSSSSKLVFSVWDAGGNDT
LDFSGFSQNQKINLNEKALSDVGGLKGNVSIAAGVTVENAIGGSGSDLLIGNDVANVLKG
GAGNDILYGGLGADQLWGGAGADTFVYGDIAESSAAAPDTLRDFVSGQDKIDLSGLDAFV
NGGLVLQYVDAFAGKAGQAILSYDAASKAGSLAIDFSGDAHADFAINLIGQATQADIVV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaattctcttgcattgaaaggtcgtagcgatgcgtatacccaggtagacaac
ttcctgcatgcctatgcgcggggcggggacgaattggtcaatggccatccgtcctatacc
gtcgaccaggcggcggagcagatcctccgcgaacaggcgtcttggcagaaagcgccgggc
gactcggtgctgaccctgtcctattcgttcctgaccaaaccgaacgacttcttcaatacg
ccgtggaagtatgtcagcgatatctactcgctgggcaagttcagcgccttttccgcgcag
cagcaggcccaggccaagttgtcgctgcaatcctggtcggacgtcaccaatatccacttc
gtcgacgccggccagggcgatcagggcgacctgaccttcggcaacttcagcagtagtgtc
ggcggtgcggcgttcgccttcctgccggatgtaccggatgcgctcaaggggcaatcctgg
tacctgatcaacagcagctacagcgccaacgtcaatccggccaacggcaactacggacgc
cagaccctgacccacgagatcggccataccctgggcctgagccaccccggcgactacaac
gccggcgagggcgatcccacctacgccgacgctacctacgccgaggacacccgcgcctat
tcggtgatgagctactgggaagagcagaacaccggccaggacttcaagggcgcctattcc
tcggcaccgctgctggacgacatcgcggcgatccagaagctctacggggccaacctgacc
actcgcaccggcgacacggtgtacggcttcaactccaacaccgagcgcgacttctacagc
gccacctcgtccagttccaagctggtgttctcggtgtgggacgccggcggcaacgacacc
ctggacttctccggcttcagccagaaccagaagatcaacctcaacgagaaggcgctgtcc
gatgtcggcgggttgaagggcaatgtgtcgatcgctgccggggtcaccgtggaaaacgcc
atcggcggctcgggtagcgacctgttgatcggcaacgacgtggccaacgtgctcaagggc
ggcgccggcaacgacatcctctacggcggcctcggcgcggaccagctgtggggtggcgcg
ggagccgacaccttcgtctacggcgatatcgccgagtcctccgcggcggcgccggatacc
ctgcgcgacttcgtcagcggccaggacaagatcgacctgtccgggctggacgccttcgtc
aacggcgggctggtgctgcaatacgtcgacgccttcgccggcaaggccggccaggcgatc
ctgtcctacgacgcggcgagcaaggccggcagcctggcgatcgacttcagcggggacgcc
catgccgatttcgcgatcaatctgatcggccaggcgacccaggccgacatcgtcgtctga

DBGET integrated database retrieval system