KEGG   Pseudomonas aeruginosa PAO1: PA1249Help
Entry
PA1249            CDS       T00035                                 

Gene name
aprA
Definition
alkaline metalloproteinase
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:pae00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PA1249 (aprA)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     PA1249 (aprA)
Peptidases [BR:pae01002]
 Metallo Peptidases
  Family M10
   PA1249 (aprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Structure
PDB: 

Jmol
Position
1355631..1357070
Genome map
AA seq 479 aa AA seqDB search
MSSNSLALKGRSDAYTQVDNFLHAYARGGDELVNGHPSYTVDQAAEQILREQASWQKAPG
DSVLTLSYSFLTKPNDFFNTPWKYVSDIYSLGKFSAFSAQQQAQAKLSLQSWSDVTNIHF
VDAGQGDQGDLTFGNFSSSVGGAAFAFLPDVPDALKGQSWYLINSSYSANVNPANGNYGR
QTLTHEIGHTLGLSHPGDYNAGEGDPTYADATYAEDTRAYSVMSYWEEQNTGQDFKGAYS
SAPLLDDIAAIQKLYGANLTTRTGDTVYGFNSNTERDFYSATSSSSKLVFSVWDAGGNDT
LDFSGFSQNQKINLNEKALSDVGGLKGNVSIAAGVTVENAIGGSGSDLLIGNDVANVLKG
GAGNDILYGGLGADQLWGGAGADTFVYGDIAESSAAAPDTLRDFVSGQDKIDLSGLDAFV
NGGLVLQYVDAFAGKAGQAILSYDAASKAGSLAIDFSGDAHADFAINLIGQATQADIVV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaattctcttgcattgaaaggtcgtagcgatgcgtatacccaggtagacaac
ttcctgcatgcctatgcgcggggcggggacgaattggtcaatggccatccgtcctatacc
gtcgaccaggcggcggagcagatcctccgcgaacaggcgtcttggcagaaagcgccgggc
gactcggtgctgaccctgtcctattcgttcctgaccaaaccgaacgacttcttcaatacg
ccgtggaagtatgtcagcgatatctactcgctgggcaagttcagcgccttttccgcgcag
cagcaggcccaggccaagttgtcgctgcaatcctggtcggacgtcaccaatatccacttc
gtcgacgccggccagggcgatcagggcgacctgaccttcggcaacttcagcagtagtgtc
ggcggtgcggcgttcgccttcctgccggatgtaccggatgcgctcaaggggcaatcctgg
tacctgatcaacagcagctacagcgccaacgtcaatccggccaacggcaactacggacgc
cagaccctgacccacgagatcggccataccctgggcctgagccaccccggcgactacaac
gccggcgagggcgatcccacctacgccgacgctacctacgccgaggacacccgcgcctat
tcggtgatgagctactgggaagagcagaacaccggccaggacttcaagggcgcctattcc
tcggcaccgctgctggacgacatcgcggcgatccagaagctctacggggccaacctgacc
actcgcaccggcgacacggtgtacggcttcaactccaacaccgagcgcgacttctacagc
gccacctcgtccagttccaagctggtgttctcggtgtgggacgccggcggcaacgacacc
ctggacttctccggcttcagccagaaccagaagatcaacctcaacgagaaggcgctgtcc
gatgtcggcgggttgaagggcaatgtgtcgatcgctgccggggtcaccgtggaaaacgcc
atcggcggctcgggtagcgacctgttgatcggcaacgacgtggccaacgtgctcaagggc
ggcgccggcaacgacatcctctacggcggcctcggcgcggaccagctgtggggtggcgcg
ggagccgacaccttcgtctacggcgatatcgccgagtcctccgcggcggcgccggatacc
ctgcgcgacttcgtcagcggccaggacaagatcgacctgtccgggctggacgccttcgtc
aacggcgggctggtgctgcaatacgtcgacgccttcgccggcaaggccggccaggcgatc
ctgtcctacgacgcggcgagcaaggccggcagcctggcgatcgacttcagcggggacgcc
catgccgatttcgcgatcaatctgatcggccaggcgacccaggccgacatcgtcgtctga

DBGET integrated database retrieval system