KEGG   Pseudomonas aeruginosa PAO1: PA1287Help
Entry
PA1287            CDS       T00035                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00480  Glutathione metabolism
pae00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PA1287
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PA1287
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PA1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 881478
NCBI-ProteinID: NP_249978
PathoGenesis: PA1287
UniProt: Q9I457
Position
1398618..1399172
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSVLALAGLPLSGWAADCPELLQGQLTKLRSKESIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAAIEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgtcctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgctgcagggccagttgaccaagctgcgttccaaggaaagc
atcgatctttgccagcgttacgccggcaagccgctggtggtggtcaacactgccagccac
tgtggcttcaccccgcagttcaaggggctcgaggcgctctaccagcgttacaaggggcag
ggcctggaagtgctcggggtaccttccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgtgcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctccagcaagaccaccccggacgatccgcagctccaggccgccatcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system