KEGG   Pseudomonas aeruginosa PAO1: PA1287Help
Entry
PA1287            CDS       T00035                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pae00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pae00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
1398618..1399172
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSVLALAGLPLSGWAADCPELLQGQLTKLRSKESIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAAIEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgtcctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgctgcagggccagttgaccaagctgcgttccaaggaaagc
atcgatctttgccagcgttacgccggcaagccgctggtggtggtcaacactgccagccac
tgtggcttcaccccgcagttcaaggggctcgaggcgctctaccagcgttacaaggggcag
ggcctggaagtgctcggggtaccttccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgtgcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctccagcaagaccaccccggacgatccgcagctccaggccgccatcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system