KEGG   Pseudomonas aeruginosa PAO1: PA1459Help
Entry
PA1459            CDS       T00035                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pae02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pae02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
1589338..1590444
Genome map
AA seq 368 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADGQIQVVGTGTNGREAIEQALALRPDVITMDYEMPL
MDGITAVRNIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVRQ
LLCEKVLTIARSNRRSISLPPLPSATSSSHAPASSSSVGASARVGAGASPAPASTSAAPK
RKAYRLVAIGTSTGGPVALQRVLTQLPANFPAPLVLIQHMPAAFTKAFAERLDKLCRINV
KEAEDGDILRPGLALLAPGGKQMMVDGRGTVRILPGDERLNYKPCVDVTFGSAAKAYNDK
VLAVVLTGMGADGREGARLLKQGGSQVWAQDEASCVIYGMPMAVVKANLADAVYGLDDIG
RHLVEACQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcggggttcttccgccgccgtgtctcggag
attctctccgccgatggacagatccaggtggtcggcaccggcaccaatggccgcgaggcc
atcgagcaggcgctggccctgagacccgatgtgatcaccatggattacgagatgccgctg
atggacggcatcaccgcggtacgcaacatcatgcagcgttgcccgaccccggtcctgatg
ttctcctcgctgacccacgagggcgcgcgggtgaccctggatgcactggacgctggagcg
gtcgactacctgccgaagaatttcgaggacatctcgcgcaacccggacaaggtccgccag
ttgctctgcgagaaggtcctgaccatcgcccgtagcaatcgtcgctcgatcagcctgccg
ccgctgccttcggccacctcgtccagccatgcgccggcgtcgtcctccagcgtcggcgcg
agcgcgcgtgttggtgccggcgcgtcgccggccccggcgtcgacctcggcggcgccgaag
cgcaaggcctaccggctggtcgcgatcggtacctccaccggtggaccggttgccttgcag
cgggtgctgacccagttgccggccaacttcccggcgccgctggtactgatccagcacatg
ccggcggccttcaccaaggccttcgccgagcgcctcgacaagctgtgccggatcaacgtc
aaggaggcggaggacggcgacatcctgcgtcccggcctggcgctgctggcgccgggcggc
aagcagatgatggtcgacggccgcggcacggtgcgcatcctccccggcgacgaacgcctg
aactacaagccctgcgtcgacgtgaccttcggctcggcggccaaggcctacaacgacaag
gtcctggcggtggtcctcaccggcatgggcgccgacgggcgcgagggtgcgcgcctgctc
aagcagggcggcagccaggtgtgggcgcaggacgaggccagttgcgtgatctacgggatg
ccgatggccgtggtcaaggccaacctggcggacgcggtgtacgggctcgacgacatcggc
cggcacctggtcgaggcgtgccagtaa

DBGET integrated database retrieval system