KEGG   Pseudomonas aeruginosa PAO1: PA1459Help
Entry
PA1459            CDS       T00035                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pae00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA1459
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PA1459
Enzymes [BR:pae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PA1459
Two-component system [BR:pae02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PA1459
Bacterial motility proteins [BR:pae02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PA1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
1589338..1590444
Genome map
AA seq 368 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADGQIQVVGTGTNGREAIEQALALRPDVITMDYEMPL
MDGITAVRNIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVRQ
LLCEKVLTIARSNRRSISLPPLPSATSSSHAPASSSSVGASARVGAGASPAPASTSAAPK
RKAYRLVAIGTSTGGPVALQRVLTQLPANFPAPLVLIQHMPAAFTKAFAERLDKLCRINV
KEAEDGDILRPGLALLAPGGKQMMVDGRGTVRILPGDERLNYKPCVDVTFGSAAKAYNDK
VLAVVLTGMGADGREGARLLKQGGSQVWAQDEASCVIYGMPMAVVKANLADAVYGLDDIG
RHLVEACQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcggggttcttccgccgccgtgtctcggag
attctctccgccgatggacagatccaggtggtcggcaccggcaccaatggccgcgaggcc
atcgagcaggcgctggccctgagacccgatgtgatcaccatggattacgagatgccgctg
atggacggcatcaccgcggtacgcaacatcatgcagcgttgcccgaccccggtcctgatg
ttctcctcgctgacccacgagggcgcgcgggtgaccctggatgcactggacgctggagcg
gtcgactacctgccgaagaatttcgaggacatctcgcgcaacccggacaaggtccgccag
ttgctctgcgagaaggtcctgaccatcgcccgtagcaatcgtcgctcgatcagcctgccg
ccgctgccttcggccacctcgtccagccatgcgccggcgtcgtcctccagcgtcggcgcg
agcgcgcgtgttggtgccggcgcgtcgccggccccggcgtcgacctcggcggcgccgaag
cgcaaggcctaccggctggtcgcgatcggtacctccaccggtggaccggttgccttgcag
cgggtgctgacccagttgccggccaacttcccggcgccgctggtactgatccagcacatg
ccggcggccttcaccaaggccttcgccgagcgcctcgacaagctgtgccggatcaacgtc
aaggaggcggaggacggcgacatcctgcgtcccggcctggcgctgctggcgccgggcggc
aagcagatgatggtcgacggccgcggcacggtgcgcatcctccccggcgacgaacgcctg
aactacaagccctgcgtcgacgtgaccttcggctcggcggccaaggcctacaacgacaag
gtcctggcggtggtcctcaccggcatgggcgccgacgggcgcgagggtgcgcgcctgctc
aagcagggcggcagccaggtgtgggcgcaggacgaggccagttgcgtgatctacgggatg
ccgatggccgtggtcaaggccaacctggcggacgcggtgtacgggctcgacgacatcggc
cggcacctggtcgaggcgtgccagtaa

DBGET integrated database retrieval system