KEGG   Pseudomonas aeruginosa PAO1: PA1481Help
Entry
PA1481            CDS       T00035                                 

Gene name
ccmG
Definition
(RefSeq) cytochrome c-type biogenesis protein CcmG
  KO
K02199  
cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
Chaperones and folding catalysts [BR:pae03110]
 Protein folding catalysts
  Protein disulfide isomerase
   PA1481 (ccmG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PathoGenesis: 
UniProt: 
Structure
PDB: 

Jmol
Position
1607065..1607607
Genome map
AA seq 180 aa AA seqDB search
MKRAILLLPLGIFLIVAVFLFRGLWLDPSELPSALIGKPFPAFDLPSVQDPARRLTEADL
KGKPALVNVWGTWCPSCRVEHPELTRLAEQGVVIYGINYKDDNAAAIKWLNELHNPYLLS
ISDADGTLGLDLGVYGAPETYLIDKQGIIRHKIVGVVDQKVWREQLAPLYQQLLDEPEAR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgagcgattctgctgctgccgctggggatcttcctgatcgtcgcggtgttcctc
ttccgcggcctctggctggaccccagcgagctgccctcggcgctgatcggcaagccgttc
ccggccttcgacctgcccagcgtgcaggacccggcccggcgcctgaccgaggccgacctc
aagggcaagccggcgctggtcaacgtctggggcacctggtgcccgtcgtgccgggtcgag
cacccggaactgacccgactggccgagcagggcgtggtgatctacgggatcaactacaag
gacgacaacgccgccgccatcaagtggctgaacgagctgcacaatccctacctgctgagc
atcagcgacgccgacggcaccctgggcctggacctgggcgtgtacggtgcgccggaaacc
tacctgatcgacaaacagggcatcatccgccacaagatcgtcggggtggtcgaccagaaa
gtctggcgcgagcaactggcgccgctgtaccagcaactgctggacgagccggaggcccga
tga

DBGET integrated database retrieval system