KEGG   Pseudomonas aeruginosa PAO1: PA1534Help
Entry
PA1534            CDS       T00035                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pae03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
1672485..1673081
Genome map
AA seq 198 aa AA seqDB search
MSFSPLIRQLIESLRILPGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQC
RTLSEEELCPQCADPRRDDSLLCVVEGPLDVFAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPELEARIRDGAFSEVILATNPTVEGEATAHYIAQLLAGRGLTLSRIAHGVPLGGELE
LVDGGTLAHALAGRRPIS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagcccgctgatccgccaactgatcgagtccctgcgcattcttcccggtgtc
gggcagaagtcggcccagcgcatggcgctgatgctgctggagcgcgatcgcagcggcggc
ctgaagctggcccaggcgttgaccgccgcgatggaaggggtcggtcattgccggcagtgc
cgtaccctcagcgaggaggagttgtgcccgcagtgcgccgacccgcgacgcgacgactcg
ctgctctgcgtggtggaaggcccgctggacgtattcgcggtggagcagaccggctaccgc
ggccgctatttcgtgctcaagggacacctgtcgccgctcgacggcctggggccggaggcg
atcggcattcccgaactggaagcgcggatcagggacggagccttcagcgaggtgatcctc
gccaccaaccccaccgtcgaaggcgaggccaccgcccactatatcgcccagctactggcc
ggccgcggcctgaccttgtcgcgtatcgcccatggcgtgccgctgggcggcgagctggag
ctggtcgatggcggcaccttggcccacgccctggccggacggcggccgatctcctga

DBGET integrated database retrieval system