KEGG   Pseudomonas aeruginosa PAO1: PA1534Help
Entry
PA1534            CDS       T00035                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PA1534 (recR)
DNA repair and recombination proteins [BR:pae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PA1534 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PA1534 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Toprim_2 HHH_5
Motif
Other DBs
NCBI-GeneID: 879372
NCBI-ProteinID: NP_250225
PathoGenesis: PA1534
UniProt: Q9I3H9
Position
1672485..1673081
Genome map
AA seq 198 aa AA seqDB search
MSFSPLIRQLIESLRILPGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQC
RTLSEEELCPQCADPRRDDSLLCVVEGPLDVFAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPELEARIRDGAFSEVILATNPTVEGEATAHYIAQLLAGRGLTLSRIAHGVPLGGELE
LVDGGTLAHALAGRRPIS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagcccgctgatccgccaactgatcgagtccctgcgcattcttcccggtgtc
gggcagaagtcggcccagcgcatggcgctgatgctgctggagcgcgatcgcagcggcggc
ctgaagctggcccaggcgttgaccgccgcgatggaaggggtcggtcattgccggcagtgc
cgtaccctcagcgaggaggagttgtgcccgcagtgcgccgacccgcgacgcgacgactcg
ctgctctgcgtggtggaaggcccgctggacgtattcgcggtggagcagaccggctaccgc
ggccgctatttcgtgctcaagggacacctgtcgccgctcgacggcctggggccggaggcg
atcggcattcccgaactggaagcgcggatcagggacggagccttcagcgaggtgatcctc
gccaccaaccccaccgtcgaaggcgaggccaccgcccactatatcgcccagctactggcc
ggccgcggcctgaccttgtcgcgtatcgcccatggcgtgccgctgggcggcgagctggag
ctggtcgatggcggcaccttggcccacgccctggccggacggcggccgatctcctga

DBGET integrated database retrieval system