KEGG   Pseudomonas aeruginosa PAO1: PA1586Help
Entry
PA1586            CDS       T00035                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PA1586 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA1586 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PA1586 (sucB)
Enzymes [BR:pae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PA1586 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
1727118..1728347
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLNEGGAAAPAAPAAAAPAAAPAAQAAAPAAAGGDDAILSPAARKL
AEEAGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAPAKPAAPAAEAPIFAAGDRVEK
RVPMTRLRAKVAERLVEAQSAMAMLTTFNEVNMKPIMDLRSKYKDLFEKKHNGVRLGFMS
FFVKAATEALKRFPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEFMSLAEIE
GGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPM
AVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccaaccttcccggaatcggtcgccgacggcaccgtcgcc
acctggcacaagaagccgggcgaagcagtcaagcgcgacgaactgatcgtcgacatcgag
accgacaaggtggtcatcgaggttctcgccgaggctgacggcgtgctggccgagatcatc
aagaacgaaggcgacaccgttctgagcaacgagctgctcggcaagctgaacgaaggcggc
gccgccgctccggccgctccggctgccgctgcgcccgccgccgctccggctgcacaggcc
gccgctccggccgccgctggcggcgacgacgccatcctgtccccggccgcgcgcaagctg
gccgaggaggccggcatcgatccgaacagcatcgccggcaccggcaagggcggtcgcgtg
accaaggaagacgtggtcgctgcggtcgaagcgaagaagaacgccccggccgccccggcc
aagcctgccgccccggctgccgaggcgccgatcttcgccgccggcgaccgtgtcgagaag
cgcgtgccgatgacccgcctgcgggccaaggtcgccgagcgcctggtcgaggcgcagtcc
gccatggccatgctgaccaccttcaacgaggtcaacatgaagccgatcatggacctgcgt
tcgaagtacaaggacctgttcgagaagaagcacaacggcgtgcgcctgggcttcatgtcc
ttcttcgtcaaggccgccaccgaggcgctgaagcgcttcccgggggtcaacgcttccatc
gacggcaacgacatcgtctaccacggctaccaggacatcggcgttgccgtttccagcgac
cgcggcctggtggttccggtactgcgtaacgccgagttcatgagcctggccgagatcgag
ggcggcatcgccaacttcggcaagaaggcgaaggaaggcaagctgaccatcgaagacatg
accggcggcaccttcaccatctccaacggtggcgtgttcggttccctgctgtcgaccccg
atcgtcaacccgccgcagaccgccatcctcggcatgcacaagatccaggagcgcccgatg
gccgtgaacggccaggtggtgatcctgccgatgatgtatctggcgctgtcctacgaccac
cgtctgatcgacggcaaggaagcggtgagcttcctggtggcgatcaaggacctgctggaa
gatccggctcgcctgctgctggacgtctga

DBGET integrated database retrieval system