KEGG   Pseudomonas aeruginosa PAO1: PA1588Help
Entry
PA1588            CDS       T00035                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00020  Citrate cycle (TCA cycle)
pae00640  Propanoate metabolism
pae00660  C5-Branched dibasic acid metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01200  Carbon metabolism
Module
pae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA1588 (sucC)
   00640 Propanoate metabolism
    PA1588 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PA1588 (sucC)
Enzymes [BR:pae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PA1588 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 882016
NCBI-ProteinID: NP_250279
PathoGenesis: PA1588
UniProt: P53593
Position
1730181..1731347
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAQQWLGKNLVTYQTDANGQPVSKILVESCTDIDKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPYQGRELAFQLGLKGDQIKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNALYRQPKLRAMHDPSQDDA
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggctttgccgtagacacccccgaagaggccgcagaagcctgcgacaagatcggcggc
agcgagtgggtcgtcaaagctcaggtgcacgccggcggccgcggtaaagcgggcggtgtg
aagctggtgaagagcaaagaggacgccaaggcgttcgcccagcagtggctgggcaagaac
ctggtgacctaccagaccgacgccaacggccagccggtcagcaagatcctggtggagtcc
tgcaccgacatcgacaaggagctgtacctcggcgccgtcgtcgatcgttccagccgccgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaggtcgcccacgacact
cccgagaagatcctcaaggctaccatcgacccgctggtcggcgcgcagccgtaccagggc
cgcgagctggccttccagctgggcctgaagggcgaccagatcaagcagttcacccatatc
ttcgtcggcctggcgaagctgttccaggactacgacctggccctgctggaagtgaacccg
ctggtgatcaagaaagacggcaacctgcactgcctggatgccaagatcaacatcgacagc
aacgccctgtaccgtcagccgaagctgcgcgccatgcacgacccgtcccaggacgacgcc
cgtgaagcccatgcgcagaagtgggagctgaactacgtcgcgctggaaggcaacatcggc
tgcatggtcaacggcgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggcggtgcgaccaaggagcgcgtgaccgaa
gcgttcaagatcatcctgtccgacagcaacgtgaaggctgtcctggtgaacatcttcggc
ggcatcgtgcgttgcgacatgatcgccgaaggcatcatcggcgccgtcaaagaagtcggc
gtgaaggttccggttgtcgtccgcctggaaggcaacaacgctgaactgggtgccaaggtc
ctggccgaaagcggcctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcaa
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system