KEGG   Pseudomonas aeruginosa PAO1: PA1748Help
Entry
PA1748            CDS       T00035                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00071  Fatty acid degradation
pae00280  Valine, leucine and isoleucine degradation
pae00281  Geraniol degradation
pae00310  Lysine degradation
pae00360  Phenylalanine metabolism
pae00362  Benzoate degradation
pae00380  Tryptophan metabolism
pae00410  beta-Alanine metabolism
pae00627  Aminobenzoate degradation
pae00640  Propanoate metabolism
pae00650  Butanoate metabolism
pae00903  Limonene and pinene degradation
pae00930  Caprolactam degradation
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01212  Fatty acid metabolism
Module
pae_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PA1748
   00650 Butanoate metabolism
    PA1748
  Lipid metabolism
   00071 Fatty acid degradation
    PA1748
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA1748
   00310 Lysine degradation
    PA1748
   00360 Phenylalanine metabolism
    PA1748
   00380 Tryptophan metabolism
    PA1748
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA1748
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PA1748
   00281 Geraniol degradation
    PA1748
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA1748
   00627 Aminobenzoate degradation
    PA1748
   00930 Caprolactam degradation
    PA1748
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PA1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 882129
NCBI-ProteinID: NP_250439
PathoGenesis: PA1748
UniProt: Q9I2Y9
Position
complement(1889323..1890012)
Genome map
AA seq 229 aa AA seqDB search
MSELISYQFEDGIATLTLNNGKVNAISPAVIDAFNQALDQALQDKAVVIVTGQPGILSGG
YDLKVMTSGPENAVNLVAAGSTLARRLLSHPYPVIVACPGHAVAKGAFLLLSADYRIGVD
GPFQIGLNEVAIGMTMHHVGIELARDRLRKSAFTRSVINAEMFSPAAAVDAGFLDTLVSA
DQLQESARAAAQQLKKLNMTAHRNTKLKVRKALLETLDQAIELDKKHLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttgatcagctaccagttcgaagacggcatcgccaccctgaccctcaacaac
ggcaaggtgaacgccatctccccggcggtgatcgacgccttcaaccaggctctcgaccag
gccttgcaggacaaggccgtggtcatcgtcactggccagccgggcatcctctccggtggc
tacgacctgaaggtcatgacctccggcccggagaatgccgtcaacctggtcgccgccggc
tcgaccctggctcgccgcttgctctcccatccctacccggtgatcgtcgcctgccccggg
cacgcggtagccaagggcgccttcctgctgctctcggccgactaccggatcggcgtcgac
gggccgttccagatcggcctgaacgaagtcgccatcggcatgaccatgcaccatgtcggc
atcgagctggcccgcgatcgcctgcgcaagtcggcgttcacccgctcggtcatcaatgcc
gagatgttcagtccggccgctgcggtggatgccggcttcctcgacaccctggtcagcgcc
gaccagttgcaggaaagcgcgcgtgcagcggcccagcagttgaagaaactcaacatgacc
gcgcaccgcaataccaagctcaaggtgcgcaaggcactgctggaaaccctcgaccaggcg
atcgagctggacaagaagcacctgggctaa

DBGET integrated database retrieval system