KEGG   Pseudomonas aeruginosa PAO1: PA2015Help
Entry
PA2015            CDS       T00035                                 

Gene name
liuA
Definition
isovaleryl-CoA dehydrogenase
Orthology
K00253  
isovaleryl-CoA dehydrogenase [EC:1.3.8.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pae00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(2205190..2206353)
Genome map
AA seq 387 aa AA seqDB search
MTYPSLNFALGETIDMLRDQVRGFVAAELQPRAAQIDQDNQFPMDMWRKFGEMGLLGITV
DEEYGGSALGYLAHAVVMEEISRASASVALSYGAHSNLCVNQIKRNGNAEQKARYLPALV
SGEHIGALAMSEPNAGSDVVSMKLRADRVGDRFVLNGSKMWITNGPDAHTYVIYAKTDAD
KGAHGITAFIVERDWKGFSRGPKLDKLGMRGSNTCELIFQDVEVPEENVLGAVNGGVKVL
MSGLDYERVVLSGGPVGIMQACMDVVVPYIHDRRQFGQSIGEFQLVQGKVADMYTALNAS
RAYLYAVAAACDRGETTRKDAAGVILYSAERATQMALDAIQILGGNGYINEFPTGRLLRD
AKLYEIGAGTSEIRRMLIGRELFNETR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcccagcctcaacttcgccctcggcgaaaccatcgacatgctccgcgaccag
gtgcgcggcttcgtcgccgccgaactgcagccgcgcgccgcgcagatcgaccaggacaat
cagttccccatggacatgtggcgcaagttcggcgagatgggcctgctcggcatcaccgtc
gacgaggagtacggcggttcggcgctgggctacctggcccacgccgtggtcatggaagag
atcagccgggcctcggcttcggtggcgctctcctatggcgcgcattccaacctctgcgtc
aaccagatcaagcgcaacggcaacgccgaacagaaggcccgctacctgccggccctggta
tccggcgaacacatcggtgcgctggcgatgagcgaacccaacgccggctccgacgtggtc
tcgatgaagctgcgcgcggaccgggtcggcgaccgcttcgttctcaacggcagcaagatg
tggatcaccaacggtcccgatgcccatacctatgtgatctacgccaagaccgacgcggac
aagggcgcgcacgggatcaccgcgttcatcgtcgagcgcgactggaaaggcttcagtcgc
gggccgaagctggacaagctgggcatgcgcggctcgaacacctgcgaactgatcttccag
gacgtcgaggtacccgaggagaacgtcctcggcgcggtcaacggcggggtcaaggtactg
atgagcggcctcgactacgagcgcgtggtgctttccggcggcccggtgggaatcatgcag
gcgtgcatggacgtggtggtgccgtacatccatgaccgccgccagttcggccagagcatc
ggcgaattccagctggtccagggcaaggtggccgacatgtacaccgccctcaacgccagc
cgcgcctacctgtacgccgtggccgccgcctgcgaccgcggcgagacgacccgcaaggac
gccgccggggtgatcctctacagcgccgagcgcgccacccagatggccctggacgcgatc
cagatcctcggcggcaacggctacatcaacgagtttcccaccggccgcctgttgcgcgac
gccaagctctacgagatcggcgccggcaccagcgagatccgccgcatgctgatcggccgc
gagctgttcaacgaaacccgctga

DBGET integrated database retrieval system