KEGG   Pseudomonas aeruginosa PAO1: PA2023Help
Entry
PA2023            CDS       T00035                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00040  Pentose and glucuronate interconversions
pae00052  Galactose metabolism
pae00500  Starch and sucrose metabolism
pae00520  Amino sugar and nucleotide sugar metabolism
pae01100  Metabolic pathways
pae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PA2023 (galU)
   00052 Galactose metabolism
    PA2023 (galU)
   00500 Starch and sucrose metabolism
    PA2023 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PA2023 (galU)
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PA2023 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 879968
NCBI-ProteinID: NP_250713
PathoGenesis: PA2023
UniProt: Q9I291
Position
2215102..2215941
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIG
DEPFAVVLADDLCLNLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVIAGEMIRD
DIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGKRFDCGSAEGYIEATNFCYENLYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtcttttcccggccgccggttacggcacccgtttcctccccgccacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacgcggtg
gaggaggcgctggaagccggcctttccgagatcggcatcgtcaccggccgcggcaagcgt
tcgctggaagaccacttcgacatcagctacgagctggaacaccagatccgcaacaccgac
aaggaaaagtacctggtcggcatccgtcggctgatcgacgagtgcaccttcgcctacacc
cgccaggtggagatgaagggcctcggccacgccatcctcaccggtcgtccgctgatcggc
gacgagccgttcgccgtggtcctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtgctgaagcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgccggaagagaccaacaagtacggcgtgatcgccggcgagatgatccgcgac
gatatcttccgggtgaacaccatggtcgagaagccgaagccggaagaggcgccgtcgaac
ctggcgatcatcggccgctacatcctgaccccggacatcttcgacctgatcgagcagact
gaaccgggcaagggcggcgagatccagatcaccgatgccctgatgaagcaggcccaggac
ggctgcgtgctggcctacaagttcaagggcaagcgtttcgactgcggcagcgccgagggt
tacatcgaggcgaccaacttctgctacgaaaacctctacaagaccggcaaggctcactga

DBGET integrated database retrieval system