KEGG   Pseudomonas aeruginosa PAO1: PA2023Help
Entry
PA2023            CDS       T00035                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pae00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pae00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pae00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pae00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
2215102..2215941
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIG
DEPFAVVLADDLCLNLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVIAGEMIRD
DIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGKRFDCGSAEGYIEATNFCYENLYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtcttttcccggccgccggttacggcacccgtttcctccccgccacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacgcggtg
gaggaggcgctggaagccggcctttccgagatcggcatcgtcaccggccgcggcaagcgt
tcgctggaagaccacttcgacatcagctacgagctggaacaccagatccgcaacaccgac
aaggaaaagtacctggtcggcatccgtcggctgatcgacgagtgcaccttcgcctacacc
cgccaggtggagatgaagggcctcggccacgccatcctcaccggtcgtccgctgatcggc
gacgagccgttcgccgtggtcctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtgctgaagcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgccggaagagaccaacaagtacggcgtgatcgccggcgagatgatccgcgac
gatatcttccgggtgaacaccatggtcgagaagccgaagccggaagaggcgccgtcgaac
ctggcgatcatcggccgctacatcctgaccccggacatcttcgacctgatcgagcagact
gaaccgggcaagggcggcgagatccagatcaccgatgccctgatgaagcaggcccaggac
ggctgcgtgctggcctacaagttcaagggcaagcgtttcgactgcggcagcgccgagggt
tacatcgaggcgaccaacttctgctacgaaaacctctacaagaccggcaaggctcactga

DBGET integrated database retrieval system