KEGG   Pseudomonas aeruginosa PAO1: PA2163Help
Entry
PA2163            CDS       T00035                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PA2163
Enzymes [BR:pae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PA2163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(2384548..2386602)
Genome map
AA seq 684 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDANGRPQRVDPEVQRGLLEALGYPAQSPQQIEQSLAALAR
LREDSANLGLLVGECGQPLEQALGPAGTPGELVYEDGTRIALRLDAEGRLPAQARSGYAQ
LSLEQREWAVAMAPPSCPSLASLAPGRSRRWGLAAQVYALRRPGDGGLGDSAALEDLLRS
AARHGADALAISPLHALAEANGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIRRAG
LAAEMARLESLELIDWTAAADLRMRLLRQLHRDFTERASPLRHDLAEFRREAGEALLHHC
RFETLQAHLGAGPDWRRWPEPLRRPGEPAVAAFCADHAEEVDFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGADGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLRANLAWPGGLRIDHVMGLQRLWLIPRGQPPHAGAYLRYPQRELLR
LLALEASRASALVIGEDLGTVPEGLREELARRQVLGTRVLLFERRGERFVPPAQWPADAM
ATTSTHDLPSLSGWWRGRDIHWRGRAGHRSAEECAADLELRAEERRALAASLEPPVDPDP
AAEVPLDACIGYVGATPAPLVLLPLEDALGSLEQPNLPGPGDAHPNWRRRWPENAAQMLG
TPQVDRRLRLLERSRRDAEEAAHD
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gacgccaacggacggccgcagcgggtcgacccggaggtccagcgcggcctgctggaagca
ctcggctatccggcgcagagtccgcaacagatcgaacagagcctggccgcgctggcccgg
ctgcgcgaggacagcgccaacctcggactgctggtcggcgaatgcggccagccgctggag
caagcgctcggccccgccggcaccccgggcgagctggtctacgaggacggcacgcggatc
gccctgcgcctggacgccgaaggccgcctgccggcgcaggcccgcagcggctatgcgcag
ctgtcgctggagcagcgggaatgggcggtggcgatggcgccgccgagctgcccgtccctg
gccagcctcgccccgggtcgctcgcgtcgctggggtctggccgcccaggtctatgccctg
cgccgccccggcgacggcggcctgggcgacagcgccgccctcgaggacctgctgcgcagc
gccgcgcggcatggcgccgacgcgctggcgatcagcccgctgcacgccctggccgaggcc
aacggacatgcctacagcccctactcgccgtccagccggctgttcttcaatgtcctgcac
gccgcgccggcgaccattctcggcgcggcggcggtggaacaggcgatccgtcgcgccggc
ctggccgcggagatggcccgcctggagagcctggagctgatcgactggacagcggcggcg
gacctgcgcatgcgcctgctgcgccaactccaccgcgacttcaccgagcgcgccagtccc
ttgcgccacgacctcgccgaattccgccgcgaagccggcgaggccctgctgcaccactgc
cgcttcgagaccctgcaggcgcacctgggcgccggccccgactggagacgctggccggag
ccgctgcgccgccccggcgagccggcggtggccgcgttctgcgccgatcacgccgaggaa
gtggacttccgtgccttcggccagtggctgacccaacgttgcctgcaacatgcccagcgc
caggcgcgcgaggccgggatggccatcggtctggtcgccgacctggcggtgggcgccgat
ggcggcggcagccaggcctggtcgcggcaggaagagctgctcgccgaagtgaatgtcggc
gcgccgccggacatcctcaaccagtccggacaggactggggcgtttccgcgttcaatccc
gaaggcctgcgccgccacggctaccgggcattccgcgagatgctgcgggccaacctggcc
tggcccggagggctacgcatcgaccatgtgatgggcctgcaacgtctctggctgatcccg
cgcggccagccgccccacgccggcgcctacctgcgctacccgcaacgcgagctgctgcgc
ctgctggcgctggaggccagtcgcgcctcggcgctggtcatcggcgaggacctcggcacc
gtgcccgaaggcctgcgcgaggaactggcacgccgccaagtgctgggtacccgcgtgctg
ctcttcgagcggcgcggcgaacgcttcgtgcccccggcgcaatggccggcggacgccatg
gccaccaccagcacccacgacctgccgagcctgtccggctggtggcggggccgggacatc
cactggcgcggccgcgccggacaccgcagcgccgaggaatgcgcggccgacctggaactg
cgcgccgaggagcgccgggcgctggccgccagcctcgaaccgccggtcgatcccgacccc
gccgccgaagtaccgctggacgcctgcatcggctatgtcggggcaacccccgcgccgttg
gtgctactgcccctggaggacgccctgggcagcctggagcagccgaacctgcccggcccc
ggcgacgcccacccgaactggcggcggcgctggccggaaaacgccgcgcagatgctcgga
acgccgcaggtcgaccggcgcctgcgcctgctcgaacgcagccgccgggatgccgaggag
gccgcccatgattga

DBGET integrated database retrieval system