KEGG   Pseudomonas aeruginosa PAO1: PA2634Help
Entry
PA2634            CDS       T00035                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00630  Glyoxylate and dicarboxylate metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PA2634 (aceA)
Enzymes [BR:pae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PA2634 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 882341
NCBI-ProteinID: NP_251324
PathoGenesis: PA2634
UniProt: Q9I0K4
Position
2977756..2979351
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKAVAALKEKNGSSWSAINPEYAARMRIQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTGLDAARAAGDKAKEAELLAQIDNFETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHIDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDLYNSFLDCEEISESELG
NGDVVIKREGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRNKLMSVEYD
DTELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcagaacgagatcaaggcagttgccgcgctgaaagagaagaacggcagc
agctggagcgcgatcaaccccgagtacgcagctcgcatgcgtatccagaaccgcttcaag
accggcctggatatcgccaagtacaccgcggccatcatgcgcaaggacatggccgaatac
gatgcggactcctccgtctacacccagtcgctgggttgctggcacggcttcatcgggcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggttggatggtcgccgcgctgcgctccgacttcggcccgctgccggaccagtccatg
cacgagaaaaccgcggtttccggcctgatcgaagagctgtacaccttcctgcgccaggct
gacgcccgcgagctggacctgctgttcaccggcctggacgctgcccgcgccgctggcgac
aaggccaaggaagccgagctgctggcccagatcgacaacttcgaaacccacgtggtgccg
atcatcgccgacatcgacgccggcttcggcaacgccgaggcgacctacctgctggccaag
aagatgatcgaagccggcgcctgctgcatccagatcgagaaccaggtgtccgacgagaag
cagtgcggccaccaggacggcaaggtcaccgttccgcacatcgacttcctcgccaagatc
aatgccgtacgctacgccttcctcgagctgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggcgccggcctgaccaagcagatcgccgtgaccaacgagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaaatctccgagtccgagctgggc
aacggcgacgtcgtgatcaagcgcgaaggcaagctgctgcgtccgaagcgcctggcttcc
aacctgttccagttccgcaagggcaccggcgaagatcgctgcgtcctggactgcatcacc
tcgctgcagaacggcgccgacctgctctggatcgaaaccgagaagccgcacgtcggccag
atcaaggcaatggtcgatcgcatccgcgaagtgattccgaacgccaagctggtctacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcaacaagctgatgagcgtcgagtacgac
gacaccgagctggccaaggtcgccgacgagaagatccgcaccttccagcgcgatggctcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgacgaaggcatgctggcctacgtgaag
ggcgtgcagcgccaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggcg
ggctccgacatcggcgacaaccataaagagtacttcgcaggcgaagccgctctgaaggcc
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system