KEGG   Pseudomonas aeruginosa PAO1: PA2826Help
Entry
PA2826            CDS       T00035                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PA2826
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PA2826
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PA2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(3179957..3180442)
Genome map
AA seq 161 aa AA seqDB search
MSDSLLSIPCTTIKGEQKTLADFGGKALLVVNTASKCGFTPQYQGLEALWEKYRERGLVV
LGFPCNQFGKQEPGDEGEISQFCELNYGVSFPLFRKIEVNGAGAHPLFVSLKKRAPGLLG
SQGIKWNFTKFLIGRDGQVVKRYAPTTKPEELSSAIEALLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgctgctgagcattccctgcaccaccatcaagggcgaacagaagaccctg
gccgacttcggcggcaaggcgctgctggtggtgaacaccgccagcaagtgcggcttcacc
ccgcagtaccaggggctggaggccttgtgggaaaaataccgtgagcgcggactggtggtg
ctcgggttcccctgcaaccagttcggcaagcaggaaccgggcgacgagggcgagatttcg
cagttctgcgaactgaactacggggtgagcttcccgctgttcaggaagatcgaggtcaac
ggcgccggcgcccacccgttgttcgtcagcctgaagaagcgcgcgccgggcctgctcggc
agccagggcatcaagtggaacttcaccaagttcctgatcggccgcgatggccaggtggtg
aagcgctatgcgccgaccaccaagccggaggagctgagctcggcgatcgaggcgctgctt
gaatga

DBGET integrated database retrieval system