KEGG   Pseudomonas aeruginosa PAO1: PA2942Help
Entry
PA2942            CDS       T00035                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PA2942
Enzymes [BR:pae01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PA2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(3297905..3298921)
Genome map
AA seq 338 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVRLDTQPPPAERAE
IIRRRLAFDADPQAFVERWEGQQDTLRRRCAEARRRLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALLHRRRQSNPPPSAANPPPPPAAA
PVALPERTGDGEGQWGELPARPVAMGTARELPRWPKKP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattaccccctgtccgccgtggtcgccgccgacgaactgaagctg
gcgctgtgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccctggcgcggggcgtcgccgaactgctgccggcgggcgagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagcctcgacctggacgcc
gccctcggcgaaggtcgcgcgcggttttccccgggcgtgctggccaaggccgacggcggc
gtgctctacgtcgacgaagtgaacctgctgccggaccacctggtggacttgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgatggcatttcccaccggcatccggcg
cgtttcgtgctgatcggcacgatgaacccggaagagggcgaactgcgcccgcaactgctc
gaccgtttcggcctcaacgtgcgtctcgacacccagccgccgccggccgagcgggcagag
atcatccgtcgccggctggccttcgatgccgacccgcaggccttcgtcgaacgctgggaa
ggccagcaggacaccctgcgccgccgttgcgccgaggcgcgccggcggctggcgcggatt
cccttggacgatgcggcgctggacagcatcgctcgacgctgcttcgaggcggctgtcgat
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagcggatcgaggcggaggacatcgatgcggtggaacatttcgccctgctgcatcgc
cgtcgccagtcgaacccgccaccatcggcggccaatccaccgccaccgcccgcggcggcc
cctgtcgcgctcccggagcgcaccggcgacggcgaagggcagtggggcgaattgccggct
cggccggtggccatggggaccgcccgcgagctgccgcgctggccaaaaaagccctga

DBGET integrated database retrieval system