KEGG   Pseudomonas aeruginosa PAO1: PA2975Help
Entry
PA2975            CDS       T00035                                 

Gene name
rluC
Definition
(RefSeq) ribosomal large subunit pseudouridine synthase C
  KO
K06179  23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
Enzymes [BR:pae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     PA2975 (rluC)
Ribosome biogenesis [BR:pae03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    PA2975 (rluC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-GeneID: 880474
NCBI-ProteinID: NP_251665
PathoGenesis: PA2975
UniProt: Q9HZM9
Position
complement(3331348..3332304)
Genome map
AA seq 318 aa AA seqDB search
MTTPASPTTGVQLLDVPPELAGQRIDNFLIARLKGAPKTLIYRILRKGEVRVNKGRIKPD
YRLQAGDQVRVPPLRLAERDEPAPLAQGLLERMEAAIVYEDKALIVVNKPAGIAVHGGSG
VSAGVIEVFRQLRPDAKDIELVHRLDRDTSGLLMIAKKRSMLRHLHEALRGEKIVDKRYH
ALVRGHWPAGKKNVRAPLLKNNLRSGERMVEVNVEGKDALTEFRVLRRFGDFATLVEARP
ITGRTHQIRVHAKHAGHAIAGDPKYGDEDFSREIRELGGKRLFLHAAQLRVPLPDGQVLE
LEAPVDEMWQRSLERLND
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactactcccgcctctccgaccaccggtgtccagctgctcgatgtgccgccggaactg
gctggtcaacgtatcgacaatttccttatcgcccgtctcaagggtgcgcccaagaccctg
atctatcgcatcctgcgtaagggcgaagtgcgcgtgaacaaggggcggatcaagcccgac
tatcggctccaggccggagaccaggtgcgcgtgccgccgctgcgcctggccgagcgtgat
gagccggcgccgctggcgcaggggctgctggagcggatggaggcggcaatcgtctacgag
gacaaggcgctgatcgtggtcaacaagcccgccgggatcgccgtgcatggcggcagcggc
gtgagcgccggggtcatcgaggtgtttcgccagttgcgccccgatgccaaggatatcgaa
ttggtgcatcgtctcgatcgcgatacctccggcctgctgatgatcgccaagaagcgcagc
atgttgcgtcacctgcatgaggccctgcggggcgagaagatcgtcgacaagcgctatcac
gccctggtccgtggccactggccggctggcaagaagaacgtgcgcgcgccgctgctgaag
aacaacctgcgttcgggcgagcgaatggtagaggtgaacgtcgagggcaaggacgcgctg
accgagttccgggtgctgcgtcgcttcggcgatttcgccaccctggtggaagcacgcccg
atcaccgggcggacccatcagatccgcgtgcatgccaagcacgccgggcatgccatcgcc
ggcgacccgaagtatggcgacgaggatttctcccgcgagatccgcgagctgggcggcaag
cgcctgttcctgcatgccgcgcagttgcgcgtgccgctgcccgacgggcaggtgctggag
ctggaggcgccggtggacgagatgtggcagcgttcgctggagcgtttgaatgactga

DBGET integrated database retrieval system