KEGG   Pseudomonas aeruginosa PAO1: PA2975Help
Entry
PA2975            CDS       T00035                                 

Gene name
rluC
Definition
ribosomal large subunit pseudouridine synthase C
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
pae  Pseudomonas aeruginosa PAO1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(3331348..3332304)
Genome map
AA seq 318 aa AA seqDB search
MTTPASPTTGVQLLDVPPELAGQRIDNFLIARLKGAPKTLIYRILRKGEVRVNKGRIKPD
YRLQAGDQVRVPPLRLAERDEPAPLAQGLLERMEAAIVYEDKALIVVNKPAGIAVHGGSG
VSAGVIEVFRQLRPDAKDIELVHRLDRDTSGLLMIAKKRSMLRHLHEALRGEKIVDKRYH
ALVRGHWPAGKKNVRAPLLKNNLRSGERMVEVNVEGKDALTEFRVLRRFGDFATLVEARP
ITGRTHQIRVHAKHAGHAIAGDPKYGDEDFSREIRELGGKRLFLHAAQLRVPLPDGQVLE
LEAPVDEMWQRSLERLND
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactactcccgcctctccgaccaccggtgtccagctgctcgatgtgccgccggaactg
gctggtcaacgtatcgacaatttccttatcgcccgtctcaagggtgcgcccaagaccctg
atctatcgcatcctgcgtaagggcgaagtgcgcgtgaacaaggggcggatcaagcccgac
tatcggctccaggccggagaccaggtgcgcgtgccgccgctgcgcctggccgagcgtgat
gagccggcgccgctggcgcaggggctgctggagcggatggaggcggcaatcgtctacgag
gacaaggcgctgatcgtggtcaacaagcccgccgggatcgccgtgcatggcggcagcggc
gtgagcgccggggtcatcgaggtgtttcgccagttgcgccccgatgccaaggatatcgaa
ttggtgcatcgtctcgatcgcgatacctccggcctgctgatgatcgccaagaagcgcagc
atgttgcgtcacctgcatgaggccctgcggggcgagaagatcgtcgacaagcgctatcac
gccctggtccgtggccactggccggctggcaagaagaacgtgcgcgcgccgctgctgaag
aacaacctgcgttcgggcgagcgaatggtagaggtgaacgtcgagggcaaggacgcgctg
accgagttccgggtgctgcgtcgcttcggcgatttcgccaccctggtggaagcacgcccg
atcaccgggcggacccatcagatccgcgtgcatgccaagcacgccgggcatgccatcgcc
ggcgacccgaagtatggcgacgaggatttctcccgcgagatccgcgagctgggcggcaag
cgcctgttcctgcatgccgcgcagttgcgcgtgccgctgcccgacgggcaggtgctggag
ctggaggcgccggtggacgagatgtggcagcgttcgctggagcgtttgaatgactga

DBGET integrated database retrieval system