KEGG   Pseudomonas aeruginosa PAO1: PA3014Help
Entry
PA3014            CDS       T00035                                 

Gene name
faoA
Definition
(RefSeq) fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00071  Fatty acid degradation
pae00280  Valine, leucine and isoleucine degradation
pae00281  Geraniol degradation
pae00310  Lysine degradation
pae00362  Benzoate degradation
pae00380  Tryptophan metabolism
pae00410  beta-Alanine metabolism
pae00640  Propanoate metabolism
pae00650  Butanoate metabolism
pae00903  Limonene and pinene degradation
pae00930  Caprolactam degradation
pae01040  Biosynthesis of unsaturated fatty acids
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01200  Carbon metabolism
pae01212  Fatty acid metabolism
Module
pae_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PA3014 (faoA)
   00650 Butanoate metabolism
    PA3014 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    PA3014 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    PA3014 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA3014 (faoA)
   00310 Lysine degradation
    PA3014 (faoA)
   00380 Tryptophan metabolism
    PA3014 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA3014 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PA3014 (faoA)
   00281 Geraniol degradation
    PA3014 (faoA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA3014 (faoA)
   00930 Caprolactam degradation
    PA3014 (faoA)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PA3014 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PA3014 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PA3014 (faoA)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PA3014 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 878680
NCBI-ProteinID: NP_251704
PathoGenesis: PA3014
UniProt: Q9HZJ2
Position
complement(3374460..3376607)
Genome map
AA seq 715 aa AA seqDB search
MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQEL
KKKAKKYDEVAKDVKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAAKL
LGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGAVK
EDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATTVA
YAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVTDPQAYEVLKPIVVEQREVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaggtaaagccatcacggttaagcctcttgagggcggcatcgtcgagttg
aatttcgatctcaagggcgagtccgtcaacaagttcaaccgtctcaccctcagtgagttg
cgtgcggcagtcgatgcgatcaaggccgatgcatcggtcaagggcgtgatcgtgaccagc
ggcaaggacgtgttcatcgttggtgccgacatcaccgagttcgttgacaacttccagctg
cccgacgaggaactgatggcgggcaacctcgaagccaacaagatcttcagcgacttcgaa
gacctggacgtacccaccgttgccgcgatcaacggcatcgccctcggcggcggcctggag
atgtgcctggccgcggacttccgcgtgatgagcgcgaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggcaccgtccgcctgccgcgcctgatcggc
tgcgataacgccgtcgagtggatcgcctcgggcaaggaaaacaaggccgaggacgccctg
aaggtcggcgccgtcgatgccgtggtcgctcccgagcaactgcaggccgctgccctcgac
ctggccaagcgcgccgtcgccggcgagctggaccacaaggcacggcgccagccgaagctg
gaaaagctgaagctgaatgcaatcgagcagatgatggccttcgaaaccgccaagggcttc
gtcgccggccaggccggtccgaactacccggcgccggtggaagccatcaagagcatccag
aaggccgccaacttcggccgcgacaaggcgctggaagtcgaagccgccggcttcgtcaag
ctggccaagacctcggtcgcgcagagtctgatcggcctgttcctgaatgaccaggaactg
aagaagaaagccaagaaatacgacgaagtcgccaaggacgtgaaactggccgccgtgctc
ggcgccggcatcatgggcggcggcatcgcctatcagtcggcgctcaagggcaccccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctgaacgaggccgccaagctg
ctcggcaagcgcgtcgagaagggtcgcctgaccccggcgaagatggccgaggcgctcaat
ggcatccgtccgaccatgtcctatggcgacttcggcaacgtcgacatcgtcgtcgaagcc
gtcgtcgagaaccccaaggtcaagcaagccgtgctcgccgaagtggaaggcgcggtgaag
gaagacgcgatcatcgcctccaacacttcgaccatctccatcagcctgctggcccaggcg
ctgaagcgtccggaaaacttctgcggcatgcatttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagaccggtgaaaccgccatcgccaccaccgtcgcc
tacgccaagaagatgggcaagagcccgatcgtggtcaacgattgcccaggcttcctggtc
aaccgtgtgctgttcccgtacttcggcggcttcgccaagctgctgagcttcggcgtcgac
ttcgtgcgcatcgacaaggtgatggagaagttcggctggcccatgggcccggcctacctg
tccgacgtggtcggcatcgacaccggccaccatggccgcgacgtcatggccgagggcttc
ccggaccgcatggcggtcgagggcaagaccgccgtcgacgtgatgtacgaggccaaccgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtcaccgatccgcaggcctacgaagtgctcaagccgatcgtggtcgagcagcgc
gaagtgaccgacgaggacatcgtcaacttcatgatgatcccgctgtgcctggaaaccgtg
cgttgcctggaagacggcatcgtcgagaccgctgccgaggccgatatgggcctgatctac
ggcatcggcttcccgcccttccgtggtggtgctctgcgctacatcgattcgatcggtgtc
gccgagttcgtggccctggccgacaagtacgccgagctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggtcagaaattcttcggttaa

DBGET integrated database retrieval system