KEGG   Pseudomonas aeruginosa PAO1: PA3392Help
Entry
PA3392            CDS       T00035                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PA3392 (nosZ)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PA3392 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
3797009..3798919
Genome map
AA seq 636 aa AA seqDB search
MSDDTKSPHEETHGLNRRGFLGASALTGAAALVGASALGSAVVGREARAAGKGERSKAEV
APGELDEYYGFWSGGHSGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESKRVLGDSAR
FLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDVMKCDRIVTIPNVQAIHGLRL
QKVPHTRYVFCNAEFIIPHPNDGSTFDLSGDNAFTLYNAIDAETMEVAWQVIVDGNLDNT
DMDYSGRFAASTCYNSEKAVDLGGMMRNERDWVVVFDIPRIEAEIKAKRFVTLGDSKVPV
VDGRRKDGKDSPVTRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTMIAIERLGDLFAGK
LADPRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQLVKWNLADAVRAYKGEKVDYIR
QKLDVQYQPGHNHATLCETSEADGKWIVVLSKFSKDRFLPTGPLHPENDQLIDISGEEMK
LVHDGPTFAEPHDCILARRDQIKTRKIWDRKDPFFAETVKRAEKDGIDLMKDNKVIREGN
KVRVYMVSMAPSFGLTEFKVKQGDEVTVTITNLDEIEDVTHGFVMVNHGVCMEISPQQTS
SITFVADKPGVHWYYCSWFCHALHMEMCGRMLVEKA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacacgaaaagcccccacgaagaaacccacggcctgaaccgccgcggcttc
ctcggcgcctcggcgctgaccggagccgccgccctggttggcgccagcgccctgggcagc
gcggtggtcggccgcgaggcccgggccgcgggcaagggcgagcgcagcaaggccgaggtc
gcccccggcgaactggatgagtactacgggttctggagcggcggacattccggcgaagta
cgcgtgctcggcgtgccgtcgatgcgcgagctgatgcgcataccggtgttcaacgtcgac
tcggccaccggctggggcctgaccaacgagagcaagcgggtcctcggcgacagcgcgcgc
ttcctcaacggcgactgccaccatccgcacatctcgatgaccgacggcaagtacgacggc
aagtacctgttcatcaacgacaaggccaacagccgggtcgcgcgcatccgcctggacgtc
atgaaatgcgaccgcatcgtcaccattcccaacgtccaggcgatccacggcctgcgcctg
caaaaggtgccgcatacccgctacgtgttctgcaacgccgagttcatcatcccccatccc
aacgacggctcgaccttcgacctgtccggcgacaacgccttcaccctgtacaacgccatc
gacgccgagaccatggaagtggcctggcaggtgatcgtcgacggcaacctcgacaacacc
gacatggactacagcggcaggttcgccgcctccacctgctacaactcggagaaggccgtc
gacctcggcggcatgatgcgcaacgagcgcgactgggtggtggtgttcgacatcccgcgc
atcgaggccgagatcaaggcgaagcgcttcgtcaccctcggcgactcgaaggtgccggtg
gtcgacggccggcgcaaggacggcaaggacagcccggtgacccgctacatcccggtaccg
aagaacccccacgggctgaacacctcgccggacggcaagtacttcatcgccaacggcaag
ctctcgccgacctgcaccatgatcgccatcgagcgcctcggcgacctgttcgccggcaag
ctggccgacccgcgcgacgtggtggtgggcgagccggaactgggcctcggcccgctgcac
accactttcgatggccgaggcaacgcctataccacgctgttcatcgacagccagttggtg
aagtggaacctggccgacgcggtgcgcgcctacaagggcgagaaggtcgactacatccgc
cagaaactcgacgtgcagtaccagccggggcacaaccacgccaccctgtgcgagaccagc
gaagccgacggcaagtggatcgtggtgctcagcaagttctccaaggaccgcttcctgccc
accggtccgctgcacccggagaacgaccagttgatcgacatttccggcgaggaaatgaag
ctggtccacgacggcccgaccttcgccgaaccgcacgattgcatcctcgcccgccgcgac
cagatcaagacccgcaagatctgggaccgcaaggacccgttcttcgccgagacggtcaag
cgcgcggaaaaggacggcatcgacctgatgaaggacaacaaggtcatccgcgagggcaac
aaggtccgcgtctacatggtctcgatggcgccctccttcggcctcaccgagttcaaggtg
aagcagggcgacgaagtcaccgtgaccatcaccaacctcgacgagatcgaggacgtgacc
cacggcttcgtcatggtcaaccacggcgtctgcatggagatcagcccgcaacagacctcg
tcgatcaccttcgtcgccgataagcccggggtgcactggtactactgcagctggttctgc
cacgccctgcacatggaaatgtgcgggcggatgctggtggaaaaggcttga

DBGET integrated database retrieval system