KEGG   Pseudomonas aeruginosa PAO1: PA3437Help
Entry
PA3437            CDS       T00035                                 

Gene name
folM
Definition
short-chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pae00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pae00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
3845053..3845757
Genome map
AA seq 234 aa AA seqDB search
MATAPILITGASQRVGLHCARRLLADGESVIVSYRSERPALDELRQAGALTLHADFASEA
GIFAFIGALRQHTDSLRAIVHNASDWVAETPGHEAEAFQQLFSVHMLAPYLINLHCAELL
ERSQPADIVHLTDDVARKGSARRIAYCASKAGLDNLTLSFAARFAPRIKVNAISPALVMF
NDGDDAEYRARTLAKSALGIEPGPEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagccccgatcctgatcaccggcgccagccagcgtgtcggcctgcattgcgcc
cgccgcctgctggccgacggcgagtcggtgatcgtcagctaccgcagcgaacgcccggcg
ctggacgaactgcgccaggccggcgcgctgaccctgcacgccgacttcgccagcgaggcc
ggcatcttcgccttcatcggggccctccgacagcataccgacagcctgcgagcgatcgtc
cacaacgcctcggactgggtcgccgagacgcccggccacgaagccgaggcgttccagcaa
ctgttcagcgtgcacatgctcgcgccctacctgatcaacctgcactgcgccgagctgctg
gaacgctcgcagcccgccgacatcgtccacctcaccgacgacgtggcgcgcaagggcagc
gcccggcgtatcgcctactgcgcgagcaaggccgggctggacaacctgaccctgtcgttc
gccgcgcgcttcgcgccgaggatcaaggtcaacgccatttcaccggcactggtgatgttc
aacgacggggacgatgccgaataccgcgcccgcaccctggcgaaatccgccctcggcatc
gaaccggggccggaagtcatctaccagagccttcgctacctgttggacaacccctacgtc
accgggaccaccctgaccgtgaacggcggccgccacgtcaagtga

DBGET integrated database retrieval system