KEGG   Pseudomonas aeruginosa PAO1: PA3438Help
Entry
PA3438            CDS       T00035                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA3438 (folE1)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PA3438 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
3845775..3846335
Genome map
AA seq 186 aa AA seqDB search
MNPALSQHYREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNGALFASDN
DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLT
RQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcactttcccagcattaccgggagatcctcgtcggtctcggcgaagacccg
cagcgcgaaggcctgctcgacaccccgaagcgcgcggccaaggccatgcagtacctctgc
cacggctatggccagaccctggaggaaatcgtcaacggcgcgctgttcgcctcggacaac
gatgaaatggtcatcgtccgcgacatcgagctgtactccctgtgcgaacaccacctcctg
cccttcatcggcaaggctcatgtggcgtacattcccaccggcaaggtgctcggcctgtcg
aaagtggcgcggatcgtcgacatgttcgcccgccgcctgcagatccaggagaacctcacc
cggcagatcgccgaggcggtccgccaggtgaccagcgccgccggcgtggcggtagtgatc
gaggcccagcacatgtgcatgatgatgcgcggggtggagaagcagaactcgcagatgttc
acctcggtgatgctcggcgcgttccgcgactcgaacaccacccgccaggaatttctgcaa
ttgatcggaaggagcaagtga

DBGET integrated database retrieval system