KEGG   Pseudomonas aeruginosa PAO1: PA3579Help
Entry
PA3579            CDS       T00035                                 

Definition
(RefSeq) carbohydrate kinase (EC:2.7.1.30)
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PA3579
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PA3579
Exosome [BR:pae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(4010523..4012007)
Genome map
AA seq 494 aa AA seqDB search
MSHYLLAIDQGTTSSRAIVFSAQGLPVASCQQEFKQYFPKDGWVEHDGEEIWLTTLQVCR
DALARKGLRAADIAAIGITNQRETTLVWDAASGDLIHPAIVWQDRRTADYCAELKAAGHE
ANVSARTGLLIDPYFSATKLRWILDNVPGARQRAERGELRFGTVDCFLLWRLTGGRSHRT
DATNASRTLLFNIHSQDWDEELLALFEIPRSLLPEVLDCAAEFGVSEPSLLGAAIPVLGM
AGDQQAALIGQACFQPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVSYAV
EGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPSALRVDGGMVVNNWMMQFLT
DILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRRFAAHMAEERRGELY
AGWQNAVRRVRSEA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactatctcctcgccatcgaccagggcaccaccagctcccgcgccatcgtgttc
agtgcccagggcttgccggtggcgagctgccagcaggaattcaagcagtacttcccgaag
gacggctgggtggagcacgacggcgaggaaatctggctgaccaccctccaggtctgtcgc
gacgcgctcgcccgcaagggcttgcgcgcggccgacatcgccgccatcggcatcaccaac
cagcgcgagaccacgctggtctgggacgccgccagcggcgacctgatccacccggccatc
gtctggcaggatcgtcgtaccgccgactactgtgccgaactcaaggccgccggccacgag
gccaatgtcagcgcgcgcaccgggctgctgatcgatccgtatttctccgccaccaagctg
cgctggatcctcgacaacgtgcccggcgcccgccagcgcgccgaacgcggcgagctgcgc
ttcggcaccgtcgactgcttcctgctctggcgcctgaccggcggccgctcccatcgcacc
gacgcgaccaacgcttcgcgcaccctgctgttcaacatccacagccaggactgggacgag
gaattgctggcgctgttcgagatcccgcgcagcctgctgccggaggtactcgactgcgcg
gcggagttcggcgtcagcgagccgtcgctgcttggcgcggcgatcccggtgctgggcatg
gccggcgaccagcaggccgcgctgatcggccaggcctgcttccagccgggcatggtgaag
agcacctacggcaccggctgcttcatgatccagaacaccggcgagcagccggtgacctcg
aagaaccgcctgctcaccacggtcggctaccgtctggacggcaaggtcagctacgcggtg
gagggcagcatcttcgtcgccggcgccgcggtgcaatggctgcgcgacggcatcaagctg
atcgaccacgcccacgaaagcgaagccctggcgatccaggccggcgactccaacggcgtc
tacctggtgccggccttcaccggcctcggcgcgccctactgggacccgaaggcgcgcggc
gcgatcttcggcctgacccgcgacaccggaatcaaggagatcgtcaccgccggtctgcaa
tcggtctgctaccagacccgcgacctgctcgaagcgatgcgccaggacggcacgccgccc
agcgcgctgcgggtggacggcgggatggtggtgaacaactggatgatgcaattcctcacc
gacatccttggcgtcaccgtggagcgcccggaagtcaccgagaccaccgccctcggcgtg
gcctacatggccgggctgaaggccggcttctatcgtgacctggacgacatcgccagccac
tggcacctgcagcgccgcttcgccgcacacatggccgaggagcgccgcggcgaactctac
gccggctggcagaacgcggtgcgacgggtgcgcagcgaggcctga

DBGET integrated database retrieval system