KEGG   Pseudomonas aeruginosa PAO1: PA3703Help
Entry
PA3703            CDS       T00035                                 

Gene name
wspF
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pae02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(4144939..4145946)
Genome map
AA seq 335 aa AA seqDB search
MRIGIVNDMPLAVEALRRALAFEPQHQIVWVASNGAEAVTQCAADTPDVVLMDLLMPVMD
GVEATRRIMAESPCAIVIVTVDIEQNVHRVFEAMGYGALDAVNTPALGIGNPQTAAAPLL
RKIQNVGWLIGQRDNRGKVQVVPPKAGGARQRLVAIGASAGGPASLAVLLKQLPASFNAA
VVLVQHVDEVFAAGMAEWLASESKLPVRLARDGEPPIPGQILLAGTNNHIRLLRNGSLVY
TAEPRSFVYRPSIDVFFESVANYWRGDAVGVLLTGMGRDGAQGLKQMRERGFLTIAQDQA
SCAVYGMPKAAAAIDAAVQILSLEKIAPRLAEVFD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaggatcggaatcgtcaatgacatgccgttggccgtcgaggcgctgcgccgcgcgctg
gccttcgagccgcagcaccagatcgtctgggtcgccagcaacggtgccgaggcggtgacc
cagtgcgccgccgatacgcccgacgtggtgctgatggacctgctcatgccggtgatggac
ggcgtcgaggcaactcgtcggatcatggcggaaagtccttgcgcgatcgtgattgttacc
gtcgatatcgagcagaatgtgcaccgggttttcgaagcgatgggatatggggcgctcgat
gcggtgaacacgccggcgctgggcatcggcaacccgcaaacggcggcggcgccgttgttg
cgcaagattcagaacgtcggctggctgatcggccagcgcgataaccgtggcaaggtccag
gtggtgccgccgaaggccggcggggcgcgccagcgtctggtggcgatcggcgcttcggct
ggcggtccggcgtcgctcgcggtgttgctcaagcaactgccggccagtttcaatgccgca
gtggtgctggtgcagcatgtcgacgaggtattcgccgccggcatggccgaatggctggcc
agcgaatcgaagctgccggtgcgcctggcgcgcgatggcgagccgccgataccggggcag
atcctgctggcggggaccaacaatcacatccgcctgctgcgcaacggttcgctggtgtac
accgccgaaccgcgttctttcgtctaccggccgtccatcgacgtgtttttcgagagcgtg
gcgaattattggcgtggcgatgccgtgggcgtgctgctgaccggcatgggccgcgacggc
gcccagggcctcaagcagatgcgcgagcgcggtttcctcaccatcgcccaggaccaggcc
agttgcgcagtctacgggatgccgaaggccgcggcggcgatcgatgcagcggtgcagatc
ctttccctggaaaagatcgccccgcgcctggcggaggtattcgattag

DBGET integrated database retrieval system