KEGG   Pseudomonas aeruginosa PAO1: PA3735Help
Entry
PA3735            CDS       T00035                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PA3735 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA3735 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PA3735 (thrC)
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PA3735 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(4186781..4188190)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWVGLPYHELAFRVMR
PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPHNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGKLSVEDQRWTEARKLFDS
LAVSDEQTCETIAEVYRSSGELLDPHTAIGVRAARECRRSLSVPMVTLGTAHPVKFPEAV
EKAGIGQAPALPAHLADLFEREERCTVLPNELAKVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagcacccgcggccaagcgcccgccctgaacttcgaagatgtcctcctc
gccggcctggccagcgacggcggcctctacgtcccggaaaacctgccacgcttcaccctc
gaggagatcgcctcctgggtcggcctgccctaccacgagctggccttccgggtgatgcgc
ccgttcgtcgccggcagcatcgccgatgccgacttcaagaagatcctcgaggaaacctat
ggcgtcttcgcccatgacgcagtggcgccgctgcgccagttgaacggcaacgaatgggtg
ctggagctgttccacggcccgaccctggccttcaaggatttcgccctgcaactgctcggc
cgcctgctcgaccatgtgctggccaagcgcggcgagcgtgtggtgatcatgggggccacc
tccggcgataccggctccgcggccatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcatgcacccgcacaaccgcgtgtccgaggtgcagcgccggcagatgaccaccatc
ctcggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaagggtacccgcctggtagcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgccgcgctgcag
ctcggcgcgccgcatcgctcggtggcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggcctgccggtcagccagctgatcgtcgcgacc
aaccgcaacgacatcctgcaccgcttcatgagcggtaatcgctacgacaaggacaccctg
catccctcgctgtcgccgtcgatggatatcatggtctcgtccaacttcgaacgcctgctg
ttcgacctgcacggccgcaacggcaaggccgtcgccgaactgctggatgccttcaaggcc
agcggcaagctgtcggtggaagaccagcgctggaccgaggcgcgcaagctgttcgactcc
ctggcggtcagcgacgagcagacctgcgagaccatcgccgaggtataccgctccagtggc
gagttgctcgacccgcacaccgccattggcgtgcgtgccgcccgcgaatgccggcgcagc
ctgagcgtgccgatggtgaccctgggcactgcgcatccggtcaagttccccgaagcggtg
gagaaggccggcatcggccaggcaccggcgctgcctgcgcacctcgccgacctgttcgag
cgcgaggagcgctgcaccgtattgccgaacgagctggccaaggtacaggccttcgtcagc
cagcacggcaatcgcggcaagccgctctga

DBGET integrated database retrieval system