KEGG   Pseudomonas aeruginosa PAO1: PA3832Help
Entry
PA3832            CDS       T00035                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PA3832 (holC)
   00240 Pyrimidine metabolism
    PA3832 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PA3832 (holC)
   03430 Mismatch repair
    PA3832 (holC)
   03440 Homologous recombination
    PA3832 (holC)
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PA3832 (holC)
DNA replication proteins [BR:pae03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PA3832 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
4290427..4290855
Genome map
AA seq 142 aa AA seqDB search
MTRVDFYVIPSADPSARLQVACRLAEKAWRQGMQVYLHCADEAQRSELDGRLWSFRGEAF
IPHSLAEEDAEAPVALGLGEPPGNHRDLLINLTLEAPGFVPNFSRVAELVVEEPAIRQAA
RDKFRFYREQGYPLQDHRLPRI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgggtcgatttctacgtgatccccagcgccgatccgtcggcgcgcctgcaggtc
gcctgccgcctggccgagaaggcctggcggcagggcatgcaggtctacctgcattgcgcc
gacgaggcgcagcgcagcgagttggacggccgcctgtggagcttccgcggcgaggccttc
attcctcacagcctggccgaggaagacgccgaggcgcccgtcgccctgggcctgggcgag
cccccggggaaccatcgcgacctgctgatcaacctgaccctcgaggcccccggcttcgtc
ccgaacttttcgcgggtggccgaactggtggtcgaggagccggcgatccgccaggcggca
cgggataaattccgcttctaccgggagcagggctatcctctacaggaccatcgcctgccg
cgtatctga

DBGET integrated database retrieval system