KEGG   Pseudomonas aeruginosa PAO1: PA4669Help
Entry
PA4669            CDS       T00035                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00900  Terpenoid backbone biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA4669 (ipk)
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PA4669 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 881380
NCBI-ProteinID: NP_253358
PathoGenesis: PA4669
UniProt: P42805
Position
5237393..5238241
Genome map
AA seq 282 aa AA seqDB search
MSVRLSLPAPAKLNLFLHILGRRDDGYHELQTLFQFLDHGDELHFEARQDGQVRLHTEIA
GVPHDSNLIVRAARGLQEASGSPQGVDIWLDKRLPMGGGIGGGSSDAATTLLALNHLWQL
GWDEDRIAALGLRLGADVPVFTRGRAAFAEGVGEKLTPVDIPEPWYLVVVPQVLVSTAEI
FSDPLLTRDSPAIKVRTVLEGDSRNDCQPVVERRYPEVRNALILLNKFVSARLTGTGGCV
FGSFPNKAEADKVSALLPDHLQRFVAKGSNISMLHRKLETLV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcctcagcctgccagccccggccaagctcaatctgttcctgcatatcctc
ggccgccgcgacgatggctatcacgagttgcagaccctgttccaattcctcgaccacggc
gacgagctgcatttcgaagcccgccaggacggccaggtacgcctgcacacggaaatcgcc
ggggtgccgcacgacagcaacctgatcgtgcgcgccgcgcgcgggctgcaggaagcctcc
ggcagcccgcaaggcgtcgacatctggctggacaagcgcttgcccatggggggcggcatc
ggcggcggcagctccgacgccgccacgacgctcctggccttgaaccatctctggcaactc
ggctgggacgaggaccgcatcgccgccctgggcctgcgcctgggcgccgacgtgccggtc
ttcacccgcggacgcgcagctttcgccgagggcgtgggcgaaaagctcaccccggtggac
atcccggagccctggtatctcgtcgtggttccgcaagtacttgtcagcacagcagaaatt
ttttcagatccactgttgacacgcgattctcccgccattaaagtgcgcaccgttctcgag
ggggacagccgaaacgactgtcagccggtagtcgagaggcgttacccagaagttcgtaac
gctttgatcttgctaaacaaatttgtttcagctagattaaccggcactggaggttgtgtg
tttgggagcttcccaaacaaagctgaagctgataaagtctcggcccttcttccagaccac
cttcagaggttcgtcgccaaaggaagcaacatctcgatgttgcaccggaagctggaaact
ctggtctga

DBGET integrated database retrieval system