KEGG   Pseudomonas aeruginosa PAO1: PA4728Help
Entry
PA4728            CDS       T00035                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pae00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
5310726..5311214
Genome map
AA seq 162 aa AA seqDB search
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVA
ALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQ
ARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatccagcgcgtctacgtggcgctgggcagcaacctggccgaaccgcgcgagcagatc
caggctgccctcgatgccttcgagcggcttcccgagacccgcctggtcgccgtctcgccg
ctctacatcagcgacccgctcggccccgccgaccagccgcgcttcgtcaacggcgtggcg
gccctcgacaccaacctggcgccgctcgacctgctcgacgccctgcaggccatcgaactg
gaacaggggcgcgtccgcgacctgcgctggggtccgcgcacgctcgacctggacatcctg
ctgttcggcgaacaattgctcgacctgccgcgcctgaaggtgccgcactaccacatgcag
gcgcgcgctttcgtgctctatcccctcgccgatctcgcccccgacctgcgcctgcccgat
ggccgccacctgccggagctgctcgcggcctgtccgttcgagggcatcgaacgccttccg
ggcgcctga

DBGET integrated database retrieval system