KEGG   Pseudomonas aeruginosa PAO1: PA4748Help
Entry
PA4748            CDS       T00035                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00010  Glycolysis / Gluconeogenesis
pae00051  Fructose and mannose metabolism
pae00562  Inositol phosphate metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01200  Carbon metabolism
pae01230  Biosynthesis of amino acids
Module
pae_M00002  Glycolysis, core module involving three-carbon compounds
pae_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA4748 (tpiA)
   00051 Fructose and mannose metabolism
    PA4748 (tpiA)
   00562 Inositol phosphate metabolism
    PA4748 (tpiA)
Enzymes [BR:pae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PA4748 (tpiA)
Exosome [BR:pae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PA4748 (tpiA)
  Exosomal proteins of bladder cancer cells
   PA4748 (tpiA)
  Exosomal proteins of melanoma cells
   PA4748 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 881712
NCBI-ProteinID: NP_253436
PathoGenesis: PA4748
UniProt: Q9HV51
Position
complement(5332746..5333501)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTHSSVAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGKAIDV
GAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCG
LVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASP
AQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNAD
EFGAICRAAGS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacccttggtggccggtaactggaaaatgcacggtacgcattccagtgtggcc
gagttgatcaaaggcttgcgtcagctggcgttgccgagcggagtcgatgtggctgtgatg
ccgccttgcttgttcatcagccaggtcatccagggcctggccggcaaggcgatcgatgta
ggtgcgcagaacagcgccgtcgagccgatgcaaggcgcgctgaccggtgagactgctccc
agtcagttggcggatgtcggttgtagcatggtccttgtgggccactcggagcgtcgcctg
attctcggcgagagtgacgaggttgtgagtcgcaagtttgccgcggctcagtcgtgcggc
ctggtgccggtgctgtgtgtcggggagacccgggcggagcgcgaggcgggcaagacgctg
gaggttgtcgcaaggcagctgggaagcgtgatcgacgagttgggtgttggagcttttgct
cgcgcagtcgtggcttacgagccggtctgggcgatcgggaccgggttgaccgcgtccccc
gcgcaagcccaggaagtgcacgcggcgatccgcgcgcaactggcagcggaaaatgccgag
gtcgcaaaaggtgtgcgactcctttacggcggcagtgtaaaggcggcaagtgcagccgag
ttgttcggcatgccggatatcgatggggggctggtaggtggagcctccctcaatgcggat
gagttcggcgcgatctgtcgtgccgcgggaagctga

DBGET integrated database retrieval system