KEGG   Pseudomonas aeruginosa PAO1: PA4918Help
Entry
PA4918            CDS       T00035                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PA4918
Enzymes [BR:pae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PA4918
    3.5.1.-  
     PA4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
5517821..5518480
Genome map
AA seq 219 aa AA seqDB search
MNRPSKIASFDVDAQKGFTPLCPDELPVPGGDAIGGALNQLASRAALRLGSKDAHSPKAA
WVVESAEQMLRPLAYPDADLTWVSHCVPGTPGFELLDELPRPIDYDFFVWKGVEPDLHPY
GACYHDLAERRSTGVIEYLRQNGVSHVLVGGLALDYCVKNTALQLRRAGFEVLLYLPACR
AIAEDTAQRACDEMRDAGVILCADLERLDSALAGADKEK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccccagcaagatcgccagcttcgatgtcgacgcccagaaaggcttcaccccg
ctgtgcccggacgaactgccggtgcccggcggcgacgccatcggcggcgccctcaaccaa
ctggccagccgcgccgcgctgcgcctgggcagcaaggacgcgcacagcccgaaggctgcc
tgggtagtggaaagcgccgagcagatgctgcggccgctggcctatccggatgccgacctg
acctgggtgagccactgcgtaccgggtacgccgggtttcgagctgctcgacgaactgccg
cggccgatcgactacgacttcttcgtctggaagggcgtggagccggacctgcatccctac
ggcgcctgctaccacgatctggcggaacgccgcagcaccggggtcatcgaatacctgagg
cagaatggcgtgagccatgtgctggtgggtggcctggcgctggactactgcgtgaagaac
accgccctgcaactgcgccgcgccggtttcgaggtgctgctctacctgcccgcctgccgg
gccatcgccgaggacaccgcgcagcgggcctgcgacgagatgcgcgacgccggggtgatc
ctctgcgccgacctggaacgactggatagcgccctcgccggcgccgacaaggagaagtga

DBGET integrated database retrieval system