KEGG   Pseudomonas aeruginosa PAO1: PA5243Help
Entry
PA5243            CDS       T00035                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pae00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(5904614..5905627)
Genome map
AA seq 337 aa AA seqDB search
MSFTPANRAYPYTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGV
ERLSIDQLLIEAEEWVALGIPALALFPVTPVEKKSLDAAEAYNPEGIAQRATRALRERFP
ELGIITDVALDPFTTHGQDGILDDDGYVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDG
RIGAIREALESAGHTNVRIMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSD
EALHEVAADLAEGADMVMVKPGMPYLDIVRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGW
LAESVILESLTAFKRAGADGILTYFAKQAAEQLRRGR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcactcccgccaatcgcgcctatccctacacccgcctgcggcgcaatcgccgc
gatgacttctcccgccgcctggtccgcgagaatgtcctcaccgtcgacgacctgatcctg
ccggtgttcgtcctcgatggggtcaaccagcgtgaaagcattccgtcgatgcccggcgtc
gagcgcctgtccatcgaccagttgctgatcgaggcggaagagtgggtggccctgggcatt
ccggcgctggcgctgttccctgtgaccccggtggagaagaagtccctggacgccgccgag
gcatacaacccggaaggcatcgcccagcgcgccacccgtgccctgcgcgagcgctttccg
gagctgggcatcatcaccgacgtggcgctcgacccgttcaccacccatggccaggacggc
atcctggatgacgatggctacgtcctcaacgacgtcagcatcgacgtgctggtacggcag
gcgctgtcccacgccgaggccggcgcccaggtggtagcgccctcggacatgatggacggt
cgcatcggtgcgatccgcgaggccctggagtctgccggccacaccaatgtgcggatcatg
gcctactcggccaagtacgccagcgcctactacggtccgttccgcgatgcggtcggctcg
gcttcgaacctcggcaagggcaacaaggccacctaccagatggatccggcgaacagcgac
gaggcacttcacgaagtggccgccgacctggccgaaggcgccgacatggtgatggtcaag
ccgggcatgccctacctcgacatcgtgcgtcgggtgaaggatgaattccgcgccccgacc
tttgtctaccaggtcagcggcgagtatgcgatgcacatgggcgccatccagaacggctgg
ctggccgaatcggtgatcctcgaatcccttaccgccttcaaacgtgccggcgccgatggc
attctgacctacttcgccaagcaggccgcagaacaattaagacgggggcgttga

DBGET integrated database retrieval system