KEGG   Pseudomonas aeruginosa PAO1: PA5259Help
Entry
PA5259            CDS       T00035                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00860  Porphyrin and chlorophyll metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PA5259 (hemD)
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PA5259 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 B12-binding
Motif
Other DBs
NCBI-GeneID: 879724
NCBI-ProteinID: NP_253946
PathoGenesis: PA5259
UniProt: P48246
Structure
PDB: 

Jmol
Position
complement(5920742..5921497)
Genome map
AA seq 251 aa AA seqDB search
MSGWRLLLTRPDEECAALAASLGEAGVHSSSLPLLAIDPLEETPEQRTLMLDLDRYCAVV
VVSKPAARLGLERLDRYWPQPPQQTWCSVGAATAAILEAYGLDVTYPEQGDDSEALLALP
AFQDSLRVHDPKVLIMRGEGGREFLAERLRGQGVQVDYLPLYRRRAPDYPAGELLARVRA
ERLNGLVVSSGQGLQNLYQLAAADWPEIGRLPLFVPSPRVAEMARELGAQRVIDCRGASA
PALLAALTSAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggctggcggctcctgctgacgcgccccgacgaggagtgcgcggccctggccgcc
agcctcggcgaggcgggcgtccatagcagcagcctgccgctgttggcgatcgatccgctg
gaagaaaccccggagcagcgtacgctgatgctcgacctggaccgctactgcgcggtggtg
gtggtcagcaagccggcggcgcgcctggggctggagcggctcgaccgctactggccgcag
ccgccgcagcagacctggtgcagcgtcggcgcggcgaccgcggcgatcctcgaggcctac
ggcctcgacgtaacctaccctgaacagggcgacgacagcgaagcgttgctggcgctgccg
gcgttccaggattccctgcgcgtgcacgatccgaaagtgctgatcatgcgcggcgaaggt
ggccgagaattcctcgccgagcgcctgcgcggccaaggcgtgcaggtggactacctgcca
ctctaccggcgccgggctccggactatccggccggagagctgctggcaagggtgcgggcg
gaacgcctgaacggcctggtggtcagcagtggacagggtttgcaaaatctgtatcagttg
gcggcagccgattggcccgagataggccggttgccgctgttcgtacccagcccgcgggtc
gccgagatggcgcgcgaactgggtgcgcaacgggtgattgattgccggggcgcgagcgcg
ccggccttgctggcggccctgacgagcgccgcctag

DBGET integrated database retrieval system