KEGG   Pseudomonas aeruginosa PAO1: PA5322Help
Entry
PA5322            CDS       T00035                                 

Gene name
algC
Definition
(RefSeq) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00010  Glycolysis / Gluconeogenesis
pae00030  Pentose phosphate pathway
pae00051  Fructose and mannose metabolism
pae00052  Galactose metabolism
pae00230  Purine metabolism
pae00500  Starch and sucrose metabolism
pae00520  Amino sugar and nucleotide sugar metabolism
pae00521  Streptomycin biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA5322 (algC)
   00030 Pentose phosphate pathway
    PA5322 (algC)
   00051 Fructose and mannose metabolism
    PA5322 (algC)
   00052 Galactose metabolism
    PA5322 (algC)
   00500 Starch and sucrose metabolism
    PA5322 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PA5322 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PA5322 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PA5322 (algC)
Enzymes [BR:pae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PA5322 (algC)
    5.4.2.8  phosphomannomutase
     PA5322 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV dCache_1 DUF2218
Motif
Other DBs
NCBI-GeneID: 879406
NCBI-ProteinID: NP_254009
PathoGenesis: PA5322
Structure
PDB: 

Jmol
Position
5991168..5993774
Genome map
AA seq 868 aa AA seqDB search
MKLFQRTAKDGNELGDLLEPEKKPRKAASERADGKDLLPGIGASLLGVAAAGALLWFGVF
GGAGEAQQRQLDAAWAEGQAGALRQALQQLAADTRAAAASPLALEALQSGDATRIEAAQR
SLLAWDGVVDAHLNAPGQAAQDNDSPGPVSFAALDILHRVESGQNVAAEAYKVGQRWLLY
SAAPVRGADQSLQGTLLLAVDLQRLLRALPPLPGDAGQVQLVQQFSGAPAQVLLQRGTPA
PGKGAQALDSGNPNWKLNYTPGSVASTQASPLLLALAALLALLGGILGTYLTRSSLLRRL
HQDVLTLGQYLQELGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPTSVPSPAKAAPVA
PVAVAKAPPREEPALADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFR
AYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDC
GCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALR
ERIEKNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEAL
GCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTG
TIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKM
KETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPE
INITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEA
DTEEELERIKTVFRNQLKAVDSSLPVPF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttccagcgcaccgccaaggatgggaacgagttgggcgacctgctcgaaccg
gaaaagaagccgcgcaaggcagcgtccgaacgcgctgacggcaaggacctgctgcccggc
ataggcgccagcctactgggcgtggcggccgccggcgccctgctctggttcggcgtcttc
ggcggcgccggtgaggcgcagcagcgccagttggacgcggcctgggccgaaggccaggcc
ggcgccttgcgccaggccttgcagcaactcgccgccgacacccgcgccgccgcggccagc
cccctcgccctcgaagccctgcaaagcggcgacgccacccgcatcgaggccgcccagcgc
agcctgctggcctgggacggcgtggtcgatgcccacctgaacgcgcccggccaggccgcc
caggacaacgacagccccggcccggtcagcttcgccgccctggatatcctgcaccgggtg
gaaagtggccagaacgtcgccgccgaagcctacaaggtcggccagcgctggttgctgtac
agcgccgcgccggtgcgcggcgccgaccagagcctgcaaggcacgctgctgctggcggtc
gacctgcaacggctgctgcgcgccctgccgcccttgccgggcgatgccggccaggtacaa
ctggtccagcagttctccggcgcaccggcccaggtgctgctgcaacgcggtacgccggcg
ccgggcaagggtgcgcaagcgctggacagcggcaatccgaactggaaactgaactacacg
cccggcagcgtcgcttcgacccaggcctcgccgctgctgctggcactcgcggcgctgctg
gcgctgctcggcggcatcctcggcacctacctcacccgttcgtcgctgttgcgccgcctg
catcaggatgtcctgaccctcggtcagtatcttcaggaactcggcgggcaacgcactgcc
aaaccccctgtgcctagcctgccgggcttcgccccgctgatccaggcattggcccgccag
ccgcggcgcaagccggagccgaccagcgtgcccagccctgccaaggcagcgccggtggcg
ccggtggcggtggcgaaagcgcctcctcgcgaggagccggcattggcagatccgttgttc
cagaacaccgacattctggatatcgacattctcgatgaagaccaggacctcctgggattg
gagcaaacccccatcatgagcactgcaaaagcaccgacgctgcccgccagcatcttccgc
gcctacgacatccgtggcgtggtaggcgataccctcaccgccgagaccgcctactggatc
ggtcgcgccatcggctcggaaagcctcgcccgcggcgaaccgtgcgtcgctgtcggccgc
gatggccgcctgtccggtcccgagctggtcaagcagctgatccagggcctggtggactgc
ggttgccaggtcagcgacgtgggcatggtgcctaccccggtgctgtactacgcggccaac
gtgctcgagggcaagtccggggtgatgctgaccggcagccacaacccgccggactacaac
ggcttcaagatcgtggtcgccggagagaccctggccaacgagcagatccaggccctgcgc
gagcgcatcgagaaaaacgacctggcatccggcgtcggcagcgtagagcaggtcgacatc
ctgccgcgctacttcaagcagatccgcgacgacatcgccatggccaagccgatgaaggtg
gtggtcgactgcggcaacggcgtggccggggtgatcgccccgcagttgatcgaggccctg
ggctgcagcgtgatcccgctgtactgcgaggtcgacggcaacttcccgaaccaccatccg
gacccgggcaagccggagaacctgaaggacctgatcgccaaggtcaaggccgagaacgcc
gacctgggcctggccttcgacggcgacggcgatcgcgtcggcgtggtcaccaataccggt
accatcatctatccggaccgtctgctgatgctgttcgccaaggacgtggtctcgcgcaac
ccgggggccgacatcatcttcgacgtcaagtgcacccgccgtctgatcgccctgatcagc
ggctacggcggccgtccggtgatgtggaagaccggccactcgctgatcaagaagaagatg
aaggaaaccggcgccctgctggctggcgagatgagcggccacgtgttcttcaaggagcgc
tggttcggcttcgacgatggcatctacagcgccgcccgcctgctggaaatcctcagccag
gatcagcgtgacagcgagcacgtgttctcggccttcccgagcgacatttccaccccggaa
atcaacatcaccgtcaccgaggacagcaagttcgccatcatcgaggcgctgcaacgcgac
gcccaatggggcgaaggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaa
ggctggggcctggtacgcgcctccaacaccactcccgtgctggtcctgcgcttcgaagcg
gacaccgaggaagagctggagcgcatcaagaccgtcttccgtaaccaactgaaggcagtg
gattcctcgctgcccgtgcccttctga

DBGET integrated database retrieval system