KEGG   Pseudomonas aeruginosa PAO1: PA5422Help
Entry
PA5422            CDS       T00035                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pae00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
6103167..6104123
Genome map
AA seq 318 aa AA seqDB search
MILLPSIRLPETAMNTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQ
PPLVWLSDEAGYRRGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDW
KIDDIAEEDGDLCVSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLS
QALHTYFAVSDSREIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLI
KDPRWERSIHLHALDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAP
GRSESFGVQIWSEPLKRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgatactgctgccatccattcgcctcccggagaccgccatgaacaccgatagcccgatc
aaccgcgtcgaacaggtacaggtcgacgacctggcctgctggcgcatccacaccgcccat
ggcgaggcgctgatcgcccagcagggcgcgcaactgctcagctaccagccccacgaacag
ccgccgctggtctggctcagcgacgaggccggctaccggcgcgggcagtcggtacgcggc
ggggtgccggtgtgctggccgtggttcggtccgctggagcgcaacccgcaggaagtccgc
ggccaggtggaagatggcctgaaggcgcccgcccacgggctggtccgggcagtcgactgg
aaaatcgacgacatcgccgaggaggacggcgacctctgcgtcagcttccgcctcgacgcc
cccgatggcctccccggctggccgcacccggcggcgctgcgcatgctgttccgcttcggc
gagcgcctgaccctgcgactcaccagcgagaacctcggcagcaagccgctggtgctcagc
caggcactgcacacctacttcgcggtcagcgacagccgcgagatcgccatcgagggcctg
gaaggcgcgcgctacatcgagaccctggagaactgggaagaacgcactcagcacggcgcg
gtacgggtcaagggcgaactggatcgcatctacctcggtctcgaacgcgacctgctgatc
aaggacccgcgctgggaacgcagcatccacctgcacgccctcgactcgcgctcggcggtg
gtctggaacccctgggtggacaagtcccggcgtctctcgcagttcgccgacgacgcctgg
cagcagatgctctgcatcgagaccgggcgggtctgggacgacctcatggtggtcgccccc
gggcgcagcgaaagctttggcgtgcagatctggagcgagccgctgaaacgaccctga

DBGET integrated database retrieval system