KEGG   Pseudomonas aeruginosa PAO1: PA5487Help
Entry
PA5487            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
Enzymes [BR:pae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PA5487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(6178036..6180051)
Genome map
AA seq 671 aa AA seqDB search
MSRDDVQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDQCMKELR
EILRRDDMDAGLSGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALDLPRELRKP
LKQFARDIEERARQSREIPILLSELSRLQRQALAERKGGDAEDGRPSLLQRLFGGKESET
TAEPSASVPSVVAASNTPIQPAAAAPSLPVAEHDEAPGGPPQPLPARTVAAIESAPAGWV
GVAERGEPNQILLDEPREIWLDSLPLPAGLSFSETLEEAGAEPSPAMPADVESAPEAPAT
PVDNLDGQAVDEAYELPPPIPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRERI
DGSLNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTDVL
DNARGFDQSLREQVSGLQASVQQATDLNSLKLAVDSRLNGLLASMDEHQREQAEHEQEVS
GRLQALMERVNSMEQDAKAFHSHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRHRDG
GDLLLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPA
TSLEAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFEGNEAGEAVFERADQALYRA
KRAGRDRLEVA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgacgacgtccagcgctggaaagacaagtacctggagaacatcgagcagcag
gagcgcctgcaacggcgctgggatgcccggatcgacctgctgcgccgcggcctggtgcgt
agcagtctggcggccgaaggcagcgacaaggcggtcgaccagtgcatgaaggagctgcgc
gagatcctccgtcgcgacgacatggacgccggcctgtcgggcctgattccgcgcctggaa
aaggccgtgctcgactccgaacagcgccgccagcaacgcacccagcagaacatcgatgct
ctcggcgaactggcccagcagttgctggccctggacctgccgcgggaactgcgcaagccg
ctgaagcagttcgcccgcgatatcgaggagcgcgcccggcagtcgcgcgagattccgatc
ctgctcagcgagctgagcaggctgcaacgccaggcgctggccgagcgcaagggcggcgat
gccgaagacggtcgcccgagcctgttgcaacgcctgttcggcggcaaggagtcggaaacc
accgcggagccgagcgcatcggtgccgtccgttgtggcggcaagcaatacaccgatccaa
ccggcggcggccgcgccgtccctgccggtcgccgagcacgacgaggcgccaggcggtccg
ccgcagccgttgcccgcccgcacggtcgccgccatcgaaagcgcgccagcgggttgggtc
ggggtcgccgagcgtggcgagccgaaccagatcctgctggatgagccccgggaaatctgg
ctcgacagcctgccgctaccggccggcctgagctttagcgagacgctggaagaagcgggt
gcggagccgtcgcccgcaatgccggcggacgttgaaagcgcgcccgaagctccggccact
cctgtggataacctcgacgggcaggcggtagacgaggcctacgaactgccgccgccgata
ccggagcccggctacagcgcggtggcgccgcacatcgaggccagcctgctgcggctgctc
gacggcctgtccctgccgagcagccaccagccccaggccgaggcgctgcgggagcggatc
gatggcagcctgaactggtatgagctggtgccggtactcgacgacctggcggtgctggtg
ctgtccctggcggacagtggccagcgcgacttcgaggaatacctgcggcaactcaacgag
cgcctggaaagcttcctcggccacctgggcgacgcccacgccggctataccgacgtgctg
gacaacgcgcgcggcttcgaccaatcgctgcgtgagcaggtcagtggcctgcaggccagc
gtgcagcaggcgaccgacctgaacagcctcaagctggcggtggacagccggctgaacggc
ctgcttgcctccatggacgaacaccagcgcgaacaggccgagcacgaacaggaggtgtcc
ggccgcctgcaggcgctgatggagcgggtcaacagcatggagcaggatgccaaggcgttc
cacagccacctggaggaccagcgacagaaagccctgaccgatccgctgaccggcctgccc
aaccgcgcggcgctcagcgagcgcctggaacaggaagtggcgcgccggcaccgggacggc
ggcgatctgctgctggcggtgctggacatcgaccacttcaagcggatcaacgacgacttc
ggccacctggccggggacaaggtgctgaagatcattgccggcgaattgcgcaaacggttg
cggcaggccgatttcatcgcccgtttcggcggcgaggagttcgtcgtcctgctcccggcc
acgtccctggaagccggccggcaactgctcgaacggctgcgcgcggcgatcgccgcctgt
ccgttccatttcaagggcgagcccctgagcatcacctgttccgccggcatcaccgcgttc
gaaggcaacgaggccggcgaagcggttttcgagcgtgccgaccaggcgctgtatcgagcc
aagcgcgccggccgggaccgcctggaagtggcctga

DBGET integrated database retrieval system