KEGG   Paenibacillus sp. FSL R5-0345: R50345_06455Help
Entry
R50345_06455      CDS       T03333                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paef  Paenibacillus sp. FSL R5-0345
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:paef00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    R50345_06455
   00630 Glyoxylate and dicarboxylate metabolism
    R50345_06455
   00640 Propanoate metabolism
    R50345_06455
   00650 Butanoate metabolism
    R50345_06455
  Lipid metabolism
   00071 Fatty acid degradation
    R50345_06455
   00072 Synthesis and degradation of ketone bodies
    R50345_06455
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R50345_06455
   00310 Lysine degradation
    R50345_06455
   00380 Tryptophan metabolism
    R50345_06455
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R50345_06455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R50345_06455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    R50345_06455
Enzymes [BR:paef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R50345_06455
Exosome [BR:paef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R50345_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1402705..1403856
Genome map
AA seq 383 aa AA seqDB search
MIEAVIVMAKRTPIGRMGGLLSTLEPEALLAPLIQHIVAETNLPVDIIDDVIIGNVVGPG
GNIARVAALEAGLPVSVPGVTVDRQCGSGLEAINIAARLIQSGAGEIYFAGGVESTSRAP
WKMAKPQTLMGIPQLYTRAHFTPSAYGDPDMGIAAENVARKYGISREEQDQYALKSHQKA
VHAQQSGQFQQEIVPLLVEGEWVHTDECPRVNTSLDKLRKLPPIFEEKGTVTAGNACPIN
DGAALLLMMSREKCRQLKLKPILRVVDAQAAGVDPNYLGMGPVPAVHKVLHRQQLTITDL
DIVEFNEAFASQVLASLNELQIPQEKVNLGGGALAIGHPYGASGAILMTRLFAEMQRTPY
KRGLATLGIGGGMGLATLVEAVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcagtgattgtcatggcaaaacgcacaccgattggcaggatgggcggctta
ttaagtacattggagccggaagcattactggcgccgcttattcagcatattgtggcagag
acaaacctgcctgtagatataatcgatgatgtcattattggaaatgtggtcggtccgggt
gggaatattgcccgggtagcagcgctcgaagcgggattgcctgtttcggttccgggtgtc
actgtggatcggcagtgcggttctgggctagaggcgattaatattgcagctaggcttatt
caaagcggtgctggtgagatttatttcgcaggcggcgttgaaagcacgagccgtgctccc
tggaagatggctaagccacagaccttgatgggtattccacagctatatacccgtgctcat
tttacacctagcgcttacggtgatccggatatggggattgctgcggaaaatgtagcgcgg
aagtacgggatttcgcgcgaagagcaggatcaatatgccttaaaaagccatcagaaggcc
gttcatgctcagcaaagtggccagtttcagcaggagattgtacctcttctggttgaggga
gagtgggtgcataccgacgaatgtcctagggtcaatacgagcttggataagctgcgaaag
ctaccgccaatttttgaagaaaagggtactgtcactgctggaaatgcttgtcctattaat
gatggtgcggcgctcttattaatgatgtcccgtgagaaatgtcggcaactcaagcttaag
cctatcctgcgtgtagtggatgcgcaagcggcaggtgtagatccgaactacttaggtatg
gggccagttccagctgtacacaaggtgttacatcgtcaacagctgaccataaccgattta
gatattgtagagtttaatgaagcctttgcttcgcaagttctagcctcactgaacgagctt
cagattccacaggaaaaggtcaatcttggaggaggcgcattagctatcggtcatccatac
ggggcgtccggagccattttaatgacgaggttatttgctgaaatgcagcgtactccttat
aaaaggggacttgccactttgggcatcggcggtgggatggggctggcaacgcttgtggag
gcggtagaatga

DBGET integrated database retrieval system