KEGG   Pseudomonas aeruginosa YL84: AI22_17820Help
Entry
AI22_17820        CDS       T03035                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paeg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AI22_17820
Enzymes [BR:paeg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AI22_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3814903..3815829
Genome map
AA seq 308 aa AA seqDB search
MQAKVLVVGSLNMDLVVRAPRLPRGGETLAGQSFITVPGGKGANQAVAAARLGAEVAMIG
CLGDDAYGDQLYRALQAEGIDCQGVERVAGESSGVALIVVDDSSQNAIVIVAGGNGHLSP
AVLARHEHLLEQAQVVVCQLESPLETVGHVLRRAHALGKTVILNPAPATRDVPADWLPLV
DYLVPNETESELLCRLPVDSLESAGRAAERLREMGAGRVIVTLGAQGALLVGEGRVEHFP
VARVKALDTTAAGDTFVGGFAAALARGLDEAAAIRFGQAAAAISVTRLGAQTSIPSREEV
ERALAGEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaaagtactggtggtgggcagcctgaacatggacctggtagtgcgcgcgccg
cgcctgccacggggcggcgagaccctcgccgggcagtccttcatcaccgttcccggcggc
aagggagccaaccaggcggtcgccgcggcgcgtctcggcgcggaggtggcgatgatcggc
tgccttggcgacgatgcctacggcgaccagttgtaccgtgcgctacaggccgagggcatc
gactgccagggcgtcgagcgggtggccggggagtccagcggagtggcgctgatcgtggtc
gacgacagcagccagaacgccatcgtcatcgtcgccggcggcaacggccacctgtcgccg
gccgtgctggcgcgccacgaacacttgctggagcaggcgcaggtggtggtctgccagctg
gaaagcccgctggagacggttggccatgtgctgcgccgggcccatgcgctgggcaagacg
gtgatcctcaacccggcgccggccacccgcgacgtgccggcggactggctgccgctggtg
gactacctggtccccaacgagaccgaaagcgaactgctctgccgcctgccggtggactcc
ctggagagcgccggacgtgccgccgagcgcctgcgcgaaatgggcgccggcagggtgatc
gtcaccctcggcgcccagggcgccctgctggtgggcgaggggcgggtcgagcatttcccg
gtggcgcgggtcaaggcgctggataccacggcggccggcgacaccttcgtcggtggcttc
gccgcggcccttgcgcgcggcctcgacgaggcggcggcgatccgtttcggccaggccgcc
gcggcgatctcggtgacccgcctcggcgcgcagacctcgatcccctcgcgcgaggaagtc
gagcgggcgctcgctggcgaggcttga

DBGET integrated database retrieval system