KEGG   Paenibacillus sp. FSL H7-0737: H70737_06305Help
Entry
H70737_06305      CDS       T03359                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00071  Fatty acid degradation
paej00280  Valine, leucine and isoleucine degradation
paej00310  Lysine degradation
paej00362  Benzoate degradation
paej00380  Tryptophan metabolism
paej00620  Pyruvate metabolism
paej00630  Glyoxylate and dicarboxylate metabolism
paej00640  Propanoate metabolism
paej00650  Butanoate metabolism
paej00900  Terpenoid backbone biosynthesis
paej01100  Metabolic pathways
paej01110  Biosynthesis of secondary metabolites
paej01120  Microbial metabolism in diverse environments
paej01130  Biosynthesis of antibiotics
paej01200  Carbon metabolism
paej01212  Fatty acid metabolism
paej02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paej00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H70737_06305
   00630 Glyoxylate and dicarboxylate metabolism
    H70737_06305
   00640 Propanoate metabolism
    H70737_06305
   00650 Butanoate metabolism
    H70737_06305
  Lipid metabolism
   00071 Fatty acid degradation
    H70737_06305
   00072 Synthesis and degradation of ketone bodies
    H70737_06305
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H70737_06305
   00310 Lysine degradation
    H70737_06305
   00380 Tryptophan metabolism
    H70737_06305
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H70737_06305
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H70737_06305
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H70737_06305
Enzymes [BR:paej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H70737_06305
Exosome [BR:paej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H70737_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C RnfC_N
Motif
Other DBs
NCBI-ProteinID: AIQ22494
UniProt: A0A089JND5
Position
1405788..1406939
Genome map
AA seq 383 aa AA seqDB search
MIEAVIIMAKRTPIGRMGGLLSTFEPEALLAPLIQHIVAETNLPVDMIDDVIIGNVVGPG
GNIARVAALEAGLPVSVPGVTVDRQCGSGLEAINIAARLIQSGAGEIYLAGGVESTSRAP
WKMAKPQTLMGVPQLYTRAHFTPSAYGDPDMGIAAENVARKYGISREEQDQYALKSHQKA
VHAQQSGRFQQEIVPLLVEGEWVNTDECPRANTSLDKLRKLPSIFEEKGTVTAGNACPIN
DGGALLLMMSREKCRQLKLKPILRVVDAQAAGVDPNYLGMGPVPAVQKVLHRQQLTIADL
DIVEFNEAFASQVLASLNELQIPQEKVNLGGGALAIGHPYGASGAILMTRLCAEMQHTPY
KRGLATLGIGGGLGLATLVEITE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcagtaattattatggcaaaacgtacaccgattggcaggatgggcggctta
ttaagtacatttgagccggaagcattactggcgccgcttattcagcatattgtggcagag
acgaatctgcccgtagatatgatcgatgatgtgattattggaaatgtggtcggtccgggt
ggaaatattgcccgggtagctgcgcttgaagcgggactgcctgtttcggttccgggcgtt
actgtggatcggcagtgcggttctgggctagaggccattaatatagcagcacggcttatt
caaagcggcgcaggtgagatttatttagcgggcggcgttgagagcacgagtcgtgcccct
tggaaaatggctaagccccaaaccttgatgggggttccgcagctatatacccgtgctcat
tttacacctagcgcttacggtgatccggatatgggaattgctgcggaaaatgtagcgcgg
aagtatgggatttcgcgagaagagcaggatcaatatgccttgaaaagccatcagaaggcc
gttcatgctcagcaaagtggtaggtttcagcaggagattgtacctcttctggttgagggg
gagtgggtgaacaccgacgaatgtccaagggctaatacgagcctggacaagctgcgaaag
ctaccttcaatctttgaagaaaagggtactgtcaccgctggaaatgcctgtcctattaat
gatggtggggcgcttctattaatgatgtcccgtgagaaatgtcggcaactcaagcttaaa
cctatcctgcgtgtcgtagatgcgcaagcagcaggtgtagatccgaattatttaggtatg
ggcccagttccagctgtacaaaaggtgttacatcgtcaacagctgaccatagcagattta
gatatcgtagagtttaatgaagcctttgcttcacaagttctagcctcactgaatgagctt
caaatcccacaagaaaaggtcaatcttggaggaggcgcattagccatcggtcatccatat
ggggcgtccggagcgattttaatgacgcgtttatgtgctgaaatgcagcatacgccttat
aaaaggggacttgccactttgggcattggcggcgggttggggctggcaacgcttgtggag
attacggaatga

DBGET integrated database retrieval system